SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038745 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038745
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily HMG-box 2.62e-26
Family HMG-box 0.00000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038745   Gene: ENSPTRG00000022469   Transcript: ENSPTRT00000041956
Sequence length 204
Comment pep:known chromosome:CHIMP2.1.4:Y:26202710:26203382:1 gene:ENSPTRG00000022469 transcript:ENSPTRT00000041956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSYASAMLSVFNSDDYSPAVQQNIPALRRSSSFLCTESYNSKYQRETGENSKDSVQDRV
KRPMNAFFVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
REKYPNYKYRPRRKANMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
GHLPPINAASSPQQRDRYSHWTKL
Download sequence
Identical sequences F2YKT8 Q28798
NP_001008988.1.37143 9598.ENSPTRP00000038745 ENSPTRP00000038745 ENSPTRP00000038745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]