SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038877 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038877
Domain Number 1 Region: 84-234
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.61e-27
Family Reprolysin-like 0.0068
Further Details:      
 
Domain Number 2 Region: 340-396
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000523
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 695-762
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000366
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 4 Region: 1024-1088
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 976-1030
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 6 Region: 906-970
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 1253-1363
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000497
Family Spermadhesin, CUB domain 0.015
Further Details:      
 
Domain Number 8 Region: 1147-1232
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000301
Family Spermadhesin, CUB domain 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000038877
Domain Number - Region: 641-700
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Domain Number - Region: 857-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0353
Family TSP-1 type 1 repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038877   Gene: ENSPTRG00000022942   Transcript: ENSPTRT00000048272
Sequence length 1385
Comment pep:known chromosome:CHIMP2.1.4:9:132894594:132934995:1 gene:ENSPTRG00000022942 transcript:ENSPTRT00000048272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQRHPRARCPPLCVAGILACGFLLGCWGPSHFQQSCLQALEPQAVSSYLSPGAPLKGRP
PSPGFQRQRQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLR
DPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRTINPEDDTDPGHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSAGRARCV
WDPPRPQPGSAGHPPDAQPGLYYSANEQCRVAFGPKAVACTFAREHLDMCQALSCHTDPL
DQSSCSRLLIPLLDGTECGVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPQSPCSRSCGG
GVVTRRRQCNNPRPAFGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDGQPLRSSP
GGASFYHWGAAVPHSQGDALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLC
VSGSCRTFGCDGRMDSQQVWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTS
VYIANHRPLFTHLAVRIGGRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPHLEE
IRIWGPLQEDADIQVYRRYGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAG
LRWVNYSCLDQARKELVETVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGL
RERPVHCVEAQGSLLKTLPPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCTSAGGA
GLALENETCVPGADGLEAPVTEGPGSVDEKLLAPEPCVGMSCPPGWGHLDATSAGEKAPS
PWGSIRMGAQAAHMWTPAAGSCSVSCGRGLMELRFLCMDSALRVPVQEELCGLASKPGSR
REVCQAVPCPARWRYKLAACSVSCGGGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPE
AQEACSLEPCPPRWKVMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACVALVRPQ
ASVPCLIADCTYRWHVGTWMECSVSCGDGIQRRRDTCLGPQVQAPVPADFCQHLPKPVTV
RGCWAGPCVGQGTPSLVPHEEAAAPGRTTATPAGASLEWSQARALLFSPAPQPRRLLPGP
QENSVQSSACGRQHLEPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDML
LLWGRLTWRKMCRKLLDMTFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQ
LFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYISIRD
THSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEVQDPQSWK
GKEGT
Download sequence
Identical sequences ENSPTRP00000038877 9598.ENSPTRP00000038877 ENSPTRP00000038877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]