SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000038918 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000038918
Domain Number 1 Region: 269-562
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.86e-62
Family Protein kinases, catalytic subunit 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-182
Classification Level Classification E-value
Superfamily Snake toxin-like 4.67e-54
Family Extracellular domain of cell surface receptors 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000038918   Gene: ENSPTRG00000014711   Transcript: ENSPTRT00000049637
Sequence length 592
Comment pep:known chromosome:CHIMP2.1.4:3:31105877:31196669:1 gene:ENSPTRG00000014711 transcript:ENSPTRT00000049637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRTAHPLRHINND
MIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENI
TLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT
SNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSTWETGKTRKLMEFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
Download sequence
Identical sequences A0A2J8NPW1 D2JYI1 G3RL67
NP_001020018.1.87134 NP_001020018.1.92137 XP_004033839.1.27298 XP_516343.2.37143 ENSP00000351905 ENSGGOP00000016505 ENSP00000351905 ENSP00000351905 ENSPTRP00000038918 gi|67782326|ref|NP_001020018.1| ENSPTRP00000038918 9598.ENSPTRP00000038918 9606.ENSP00000351905 ENSGGOP00000016505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]