SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039394 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039394
Domain Number 1 Region: 1119-1156,1206-1319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.9e-18
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039394   Gene: ENSPTRG00000019968   Transcript: ENSPTRT00000037012
Sequence length 1402
Comment pep:known scaffold:CHIMP2.1.4:GL390916.1:160932:226422:-1 gene:ENSPTRG00000019968 transcript:ENSPTRT00000037012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQTLRLNSESPKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRL
PPRPENCRLEDEGVNTSPYSKPTIAVKPTMMSSEASDVWTEANLSAEVSQVIWRRAPGKL
PLPKQEDASVVYLGSFRGVQKPAGPSTSPDGNSRCPPAYTMVGLHNLEPRGERNIAFHPV
RFPDEKAGHKEKPSFPYQDRPSTQESFRQKLAAFAGTTSGCHQGPGPLRESLPSEDDSDQ
RCSPSGDSEGGEYCSILDCCPGSPVAKAASQTAGSWGRHGGRDCSPTCWEQGKCSGPAEQ
EKRGPSFPKECCSQGPTAHPSCLGPKKLSLTSEAAISSDGLSCGSGSGSGSGASSPFVPH
LESDYCSLMKEPAPEKQQDPGCPGVTPSRCLGLTGEPQPPAHPREATQPEPIYAESTKRK
KAAPVPSKSQAKIEHAAAAQGQGQVCTGNAWAQKTASGWGRDSPDPTPQVSATITVMAAH
PEEDHRTIYLSSPDSAVGVQWPRGPVSQNSEVGEEETSAGQGLSSRQSHAHSASESKPKE
RPAIPPKLSKSSPVGSPVSPSAGGPPVSPLADLSDGSSGGSSIGPQPPSQGPADPAPSCR
TNGVTISDPSRCPQPAASSASEQRRPRFQAGTWSRQCRIEEEEEVEQELLSHSWGRETKN
GPTDHSNSTTWHRLHPTDGSSGQNSKVGTGMSKSASFAFEFPKDRSGIETFSPPPPPPKS
RHLLKMNKSSSDLEKVSQGSAESLSPSFRGVHVSFTTGSTDSLASDSRTCSDGGPSSELA
HSPTNSGKKLFAPVPFPSGSTEDVSPSGPLQPPPLPQKKIVSRAASSPDGFFWTQGSPKP
RTASPKLNLSHSETNVHDESHFSYSLSPGNRHHPVFSSSDPLEKAFKGSGHWLPAAGLAG
NRGGCGSPGLQCKGAPSASSSQLSVSSQASTGSTQLQLHGLLSNISSKEGTYAKLGGLYT
QSLARLVAKCEDLFMGGQKKELHFNENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGST
YAVKICKTPEPKTVSYCSPSVPVHFNIQQDCGHFVASVPSSMLSSPDAPKDPVPALPAHP
PAQEQDCVVVITREVPHQTASDFVRDSAASHQAEPEAYERRVCFLLLQLCNGLEHLKEHG
IIHRDLCLENLLLVHCTLQAGPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAAGPASPEGP
REKQLPRLIISNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTGILIYEL
LHQPNPFEVRAQLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKRV
LQCLLWGPRRELVQQPGTSEEALCGTLHNWIDMKRALMMMKFAEKAVDRRRGVELEDWLC
CQYLASAEPGALLQSLKLLQLL
Download sequence
Identical sequences ENSPTRP00000039394 9598.ENSPTRP00000039394 ENSPTRP00000039394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]