SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000039456 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000039456
Domain Number 1 Region: 571-634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000987
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 499-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000123
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 3 Region: 626-682
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000039456
Domain Number - Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000101
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number - Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000039456   Gene: ENSPTRG00000016824   Transcript: ENSPTRT00000031228
Sequence length 843
Comment pep:known chromosome:CHIMP2.1.4:5:74121699:74195394:-1 gene:ENSPTRG00000016824 transcript:ENSPTRT00000031228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCAGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRTSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKCSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRSLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGDPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCARDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAV
ETQ
Download sequence
Identical sequences H2QZS3
XP_001138984.2.37143 9598.ENSPTRP00000039456 ENSPTRP00000039456 ENSPTRP00000039456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]