SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040371 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040371
Domain Number 1 Region: 488-773
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-81
Family Protein kinases, catalytic subunit 0.000000157
Further Details:      
 
Domain Number 2 Region: 62-183
Classification Level Classification E-value
Superfamily L domain-like 5.1e-23
Family Ngr ectodomain-like 0.000000556
Further Details:      
 
Domain Number 3 Region: 289-380
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.00000372
Further Details:      
 
Domain Number 4 Region: 194-289
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000014
Family I set domains 0.00000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040371   Gene: ENSPTRG00000001478   Transcript: ENSPTRT00000043472
Sequence length 790
Comment pep:known chromosome:CHIMP2.1.4:1:135161499:135182974:1 gene:ENSPTRG00000001478 transcript:ENSPTRT00000043472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGISVAVGLAV
FACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGL
QGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKAL
KEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGP
DAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKI
GDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQ
PWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQ
APPVYLDVLG
Download sequence
Identical sequences H2R096
ENSPTRP00000040371 ENSPTRP00000040371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]