SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040418 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040418
Domain Number 1 Region: 217-427
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.3e-51
Family Reprolysin-like 0.0036
Further Details:      
 
Domain Number 2 Region: 518-574
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000484
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040418   Gene: ENSPTRG00000001576   Transcript: ENSPTRT00000048286
Sequence length 837
Comment pep:known chromosome:CHIMP2.1.4:1:139536502:139544391:-1 gene:ENSPTRG00000001576 transcript:ENSPTRT00000048286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTGSHPGRGLAGRWLWGAQPCLLLPIVPLSWLVWLLLLLLASLLPSARLASPLPREEE
IVFPEKLNGSVLPGSGAPARLLCRLQAFGETLLLELEQDSGVQVEGLTVQYLGQAPELLG
GAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHI
LRRKSPASGQGPMCNVKAPLGSPSPRPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKR
YLLTVMAAAAKAFKHPSIRNPVSLVVTRLVILGSGEEGPQVGPSAAQTLRSFCAWQRGLN
TPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAA
HELGHVFNMLHDNSKPCISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGY
GHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHA
MCQTKHSPWADGTPCGPAQACMGGRCLHMDQLQDFNIPQAGGWGPWGPWGDCSRTCGGGV
QFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTEDCPTGSALTFREEQCAAYNHRTDLFKSF
PGPMDWVPRYTGVAPQDQCKLTCQARALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHA
GCDRIIGSKKKFDKCMVCGGDGSGCSKQSGSFRKFRYGYNDVVTIPAGATHILVRQQGNP
GHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQP
LTLQVLVAGNPQDARLRYSFFVPRPTPSTPRPTPQDWLHRRAQILEILRRRPWAGRK
Download sequence
Identical sequences A0A2I3T896
9598.ENSPTRP00000040418 XP_003811884.1.60992 XP_513940.2.37143 ENSPTRP00000040418 ENSPTRP00000040418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]