SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040515 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040515
Domain Number 1 Region: 5-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-86
Family Protein kinases, catalytic subunit 0.0000000000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040515   Gene: ENSPTRG00000014365   Transcript: ENSPTRT00000046730
Sequence length 416
Comment pep:known chromosome:CHIMP2.1.4:22:36944350:36971031:-1 gene:ENSPTRG00000014365 transcript:ENSPTRT00000046730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARN
PEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAG
NTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK
Download sequence
Identical sequences A0A096NK14 A0A2K5EK36 A0A2K5IVA2 A0A2K5RX94 A0A2K5ZG34 A0A2K6B7J2 A0A2K6MKG4 A0A2K6QVN4 A0A2K6UL40 F6R2T7 G1RYN2 G3RJC8 G7PFF2 H2P4D3 H2R0C8 P49674 Q5U045
9544.ENSMMUP00000024099 9598.ENSPTRP00000040515 9600.ENSPPYP00000013183 9606.ENSP00000352929 ENSMMUP00000013233 ENSP00000352929 ENSP00000380044 ENSP00000383067 ENSP00000384074 ENSPPYP00000013183 CSNK1E gi|23199991|ref|NP_689407.1| gi|4503093|ref|NP_001885.1| ENSNLEP00000018359 ENSP00000352929 ENSNLEP00000018359 ENSGGOP00000015812 ENSPTRP00000040515 ENSP00000352929 ENSP00000380044 ENSP00000383067 ENSP00000384074 ENSPANP00000013318 ENSGGOP00000015812 ENSMMUP00000013233 ENSMMUP00000024099 ENSMMUP00000037009 ENSPTRP00000040515 ENSPPYP00000013183 NP_001248581.1.72884 NP_001276841.1.87134 NP_001276841.1.92137 NP_001885.1.87134 NP_001885.1.92137 NP_689407.1.87134 NP_689407.1.92137 XP_003264796.1.23891 XP_003264797.1.23891 XP_004088479.1.23891 XP_005567360.1.63531 XP_007973946.1.81039 XP_007973947.1.81039 XP_008973332.1.60992 XP_008973333.1.60992 XP_009436672.1.37143 XP_010341773.1.74449 XP_010341774.1.74449 XP_010341775.1.74449 XP_010387536.1.97406 XP_011710685.1.29376 XP_011710686.1.29376 XP_011819620.1.43180 XP_011819621.1.43180 XP_011819622.1.43180 XP_011834255.1.47321 XP_011834256.1.47321 XP_011834258.1.47321 XP_012314365.1.9421 XP_012314366.1.9421 XP_012314367.1.9421 XP_012314368.1.9421 XP_012314370.1.9421 XP_012363181.1.23891 XP_017364481.1.71028 XP_017364483.1.71028 XP_017364484.1.71028 XP_017716793.1.44346 XP_017716794.1.44346 XP_018873814.1.27298 XP_515128.3.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]