SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040565 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040565
Domain Number 1 Region: 950-1008
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000759
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 722-786
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000353
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 3 Region: 158-214
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000116
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 841-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 895-955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 675-719
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000837
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 788-838
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000811
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040565   Gene: ENSPTRG00000022572   Transcript: ENSPTRT00000048344
Sequence length 1052
Comment pep:known chromosome:CHIMP2.1.4:9:133012959:133053041:1 gene:ENSPTRG00000022572 transcript:ENSPTRT00000048344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFEVGEGGGAGEEGKGRGRPGXQLCTHAAPARTAHLAPSALRSARPFLWEDNLLTRSQG
LPGNHDQLVPDNLEAWALAGPRGLFPKRTLVIWKRSGAGLVVTVALLPRMDGRWQCSCWA
WFLLVLAVVAGDTVSTGSTDNSPTSNSLEGGTDATAFWWGEWTKWTACSRSCGGGVTSQE
RHCLQQRRKSVPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSFNSHVYNGRTHQ
WKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVCVSGKCEPIGCD
GVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGARDIQIVERKKSA
DVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYIVAQGPTNQGLN
VMVWNQNGKSPSITFEYTLLQPPHESRPQPIYYGFSEPASESAESQGLDGAGLMGFVPHN
GSLYGQASSERLGLDNRLFGHPGLDMELGQSQGQETNEVCEQAGGGACEGPPRGKGFRDH
NVTGTPLTGDKDDEEVDTHFASQEFFSANAISDQLLGAGSDLKDFTLNETVNSIFAQGAP
RSSLAESFFVDYEENEGAGPYLLNGSYLELSSDRVANSSSEAPFPNVSTSLPTSAGNRTH
KARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSAYAMCVRYDGVEVDDSYCDAL
TRPEPVWETSSWSECSRTCGEGYQFRVVRCWKMLSPGFDSSVYSDLCEAAEAVRPEERKT
CRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSEDEKLCDPNTRPVGEKNCTGPPCDR
QWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQCQMETKPLAIHPCGDKNCPAHWL
AQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPECGLAKKPPEESTCFERPCFKWYT
SPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKPVGRQACDLQPCPTEPPDDSCQDQ
PGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences ENSPTRP00000040565 ENSPTRP00000040565 9598.ENSPTRP00000040565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]