SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040907 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040907
Domain Number 1 Region: 310-418
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-46
Family ets domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 159-251
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.4e-28
Family Pointed domain 0.0000138
Further Details:      
 
Domain Number 3 Region: 38-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000278
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040907   Gene: ENSPTRG00000013810   Transcript: ENSPTRT00000046827
Sequence length 454
Comment pep:known chromosome:CHIMP2.1.4:21:11923713:11961472:1 gene:ENSPTRG00000013810 transcript:ENSPTRT00000046827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV
EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Download sequence
Identical sequences A0A2J8UKJ1 A8IE48 G1QQ27 G3RDF3 H2R0L6 Q06546
9598.ENSPTRP00000040907 9606.ENSP00000346886 NP_001184226.1.87134 NP_001184226.1.92137 NP_002031.2.87134 NP_002031.2.92137 XP_003263844.1.23891 XP_003263845.1.23891 XP_003819257.1.60992 XP_003819258.1.60992 XP_005260995.1.92137 XP_008970810.1.60992 XP_008970811.1.60992 XP_008970812.1.60992 XP_011527822.1.92137 XP_011527823.1.92137 XP_014198617.1.60992 XP_016793934.1.37143 XP_016793935.1.37143 XP_016793936.1.37143 XP_016793937.1.37143 XP_016793938.1.37143 XP_016793939.1.37143 XP_016883802.1.92137 XP_018873282.1.27298 XP_018873283.1.27298 ENSNLEP00000003045 ENSNLEP00000024204 ENSPTRP00000040907 ENSPTRP00000040907 ENSP00000346886 ENSP00000382948 gi|308818209|ref|NP_001184226.1| gi|34452721|ref|NP_002031.2| ENSP00000346886 ENSP00000382948 ENSNLEP00000003045 ENSP00000346886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]