SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041462 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000041462
Domain Number - Region: 59-166
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.000824
Family Brix domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041462   Gene: ENSPTRG00000010459   Transcript: ENSPTRT00000047909
Sequence length 473
Comment pep:known chromosome:CHIMP2.1.4:19:10294108:10299176:1 gene:ENSPTRG00000010459 transcript:ENSPTRT00000047909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTAS
RLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRD
VVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRC
LLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSES
EAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSF
VRKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSD
EEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGKAPSEDLFPEAKRKRLAKSPGRKRK
RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGQGRGRPGKRVA
Download sequence
Identical sequences H2R0Y5
ENSPTRP00000041462 NP_001191357.2.37143 ENSPTRP00000041462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]