SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041706 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041706
Domain Number 1 Region: 418-606
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-16
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 2 Region: 621-816
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-16
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 3 Region: 830-1029
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000196
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 4 Region: 308-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 5 Region: 108-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000073
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 146-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 7 Region: 224-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000872
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 184-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.006
Further Details:      
 
Domain Number 9 Region: 1059-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 74-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000458
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1175-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000596
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1094-1133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000366
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000041706
Domain Number - Region: 258-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00543
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1141-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041706   Gene: ENSPTRG00000021348   Transcript: ENSPTRT00000043704
Sequence length 1285
Comment pep:known chromosome:CHIMP2.1.4:9:122408723:122431966:1 gene:ENSPTRG00000021348 transcript:ENSPTRT00000043704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARPGTPDPQALASVLLLLLWAPALSLLAGTVPSEPPSACASDPCAPGTECQATESGG
YTCGPMEPRGCATQPCHHGALCVPQGPDPNGFRCYCVPGFQGPRCELDIDECASRPCHHG
ATCRNLADRYECHCPLGYAGVTCETEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGTR
CQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGAHCEREVLECASAPCAHNASCLE
GLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDPALYGGVQATFPGAFSFRH
AAGFLCHCSPGFEGADCGVEVDECASRPCLNGGHCQDLPNGFQCHCPDGYAGPTCEEDVE
ECLSDPCLHGGTCSDTVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCIPTFESGVH
SYVCHCPPGTHGPFCGQNTTFSVMAGSPIQASVPAGGPLGLALRFRTTLPAGTLATRNDT
KESLELALVAATLQATLWSYSTTVLVLRLPDLALNDGHWHQVEVVLHLATLELRLWHEGC
PARLCVASGPVALASTASATPLPAGISSAQLGDATFAGCLQDVRVDGHLLLPEDLGENVL
LGCERREQCQPLPCVHGGSCVDLWTHFRCDCARPHRGPTCADEIPAATFGLGGAPSSASF
LLQELPGPNLTVSFLLRTREPAGLLLQFANDSAAGLTVFLSEGRIRAEAPGSPAVVLPGR
WDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFF
PLPLDNSSQPSELGGRQSWNLTVGCVSEDMCSPDPCFNGGTCLVTWNDFHCTCPANFTGP
TCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAAFSGHNASSGRLLGGLSLAF
RTRDSEAWLLRAAAGALEGVWLAVRNGSLAGGVRGGHGLPGAVLPIPGPRVADGAWHRVR
LAMERPAAATSRWLLWLDGAATPVALRGLASDLGFLQGPGAVRILLAENFTGCLGRVALG
GLPLPLARPRPGAAPGAREHFASWPGTPAPILGCRGAPVCAPSPCLHDGACRDLFDAFAC
ACGPGWEGPRCEAHVDPCHSAPCARGRCHTHPDGRFECRCPPGFGGPRCRLPVPPKECGL
NVTCLDGSLCEGGSPAANCSCLEGLAGQRCQVPTLPCEANPCLNGGTCRAAGGVSECICN
ARFSGQFCEVAKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSP
SQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences ENSPTRP00000041706 9598.ENSPTRP00000041706 ENSPTRP00000041706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]