SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041771 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041771
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily PX domain 6.15e-25
Family PX domain 0.0016
Further Details:      
 
Domain Number 2 Region: 190-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.04e-20
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041771   Gene: ENSPTRG00000015058   Transcript: ENSPTRT00000046700
Sequence length 580
Comment pep:known chromosome:CHIMP2.1.4:3:59225676:59319398:1 gene:ENSPTRG00000015058 transcript:ENSPTRT00000046700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFD
LLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLD
PNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSW
ADLGPDKYLSDKDFQCLIKLLPSCLHPYIYRVTFATANESSALLIRMFNEKGTLKDLIYK
AKPKDPFLKKYCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHASNVMLDGDT
CRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRPPDSVPVDSFP
PAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVLLTTSEKPQFKIPTKLKEALR
IAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSALENSEEHSA
KYSNSNNSAGSGASSPLTSPSSPTPPSTSGISALPPPPPPPPPPPPAAPLPPASTEAPAQ
LSSQAVNGMSRGALLSSIQNFQKGTLRKAKTCDHSAPKIG
Download sequence
Identical sequences A0A2I3S9L0
9598.ENSPTRP00000041771 XP_001174144.1.37143 ENSPTRP00000041771 ENSPTRP00000041771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]