SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042330 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042330
Domain Number 1 Region: 83-384
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-97
Family Protein kinases, catalytic subunit 0.0000000000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042330   Gene: ENSPTRG00000000899   Transcript: ENSPTRT00000050257
Sequence length 398
Comment pep:known chromosome:CHIMP2.1.4:1:84867406:84962665:1 gene:ENSPTRG00000000899 transcript:ENSPTRT00000050257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
Download sequence
Identical sequences A0A2I3GCI8 G3SC72 H2R1G3
ENSP00000359719 9598.ENSPTRP00000042330 9606.ENSP00000359719 NP_891993.1.87134 NP_891993.1.92137 XP_001137476.1.37143 XP_003260296.1.23891 XP_004026083.1.27298 ENSP00000359719 ENSPTRP00000042330 ENSPTRP00000042330 ENSNLEP00000012066 ENSGGOP00000025699 gi|33636738|ref|NP_891993.1| ENSGGOP00000025699 ENSP00000359716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]