SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042420 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042420
Domain Number 1 Region: 1-285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-92
Family Protein kinases, catalytic subunit 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042420   Gene: ENSPTRG00000017722   Transcript: ENSPTRT00000043180
Sequence length 623
Comment pep:known chromosome:CHIMP2.1.4:6:10853417:10926893:-1 gene:ENSPTRG00000017722 transcript:ENSPTRT00000043180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLREVKSLKKLNHA
NVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPESVIRNIMYQILQGLAFIHKHG
FFHRDMKPENLLCMGPELVKIADFGLARELRSQPPYTDYVSTRWYRAPEVLLRSSVYSSP
IDVWAVGSIMAELYMLRPLFPGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQ
CVPINLKTLIPNASNEAIQLMTEMLNWDPKKRPTASQALKHSYFQVGQVLGPSSNHLESK
QSLNKQLQPLESKPSLVEVEPKPLPDIIDQAVGQPQPKTSQQPLQPIQPPQNLSVQQPPK
QQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHS
KKPSMGVFKEKRKKDSPFRLPEPVPSGSNHSTGENKSLPAVTSLKSDSELSTAPTSKQYY
LKQSRYLPGVNPKKVSLIASGKEINPHTWSNQLFPKSLGPIGAELAFKRRNAGNLGSYAT
YDQSGYIPSFLKKEVQSAGQRIHLAPLNATASEYTWNTKTGRGQFSGRTYNPTAKNLNIV
NRAQPIPSVHGRTDWVAKYGGHR
Download sequence
Identical sequences A0A2I3S518
ENSPTRP00000042420 9598.ENSPTRP00000042420 ENSPTRP00000042420 XP_001167665.1.37143 XP_016810375.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]