SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042846 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000042846
Domain Number - Region: 111-152
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0162
Family FCH domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042846   Gene: ENSPTRG00000004703   Transcript: ENSPTRT00000044311
Sequence length 196
Comment pep:known chromosome:CHIMP2.1.4:12:12622518:12730052:1 gene:ENSPTRG00000004703 transcript:ENSPTRT00000044311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEG
ERLEPFTMKPDRELRL
Download sequence
Identical sequences H2R1T3
ENSPTRP00000042846 XP_001139139.2.37143 ENSPTRP00000042846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]