SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043096 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043096
Domain Number 1 Region: 161-237,387-546
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.85e-42
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 44-141
Classification Level Classification E-value
Superfamily MIT domain 1.96e-21
Family MIT domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043096   Gene: ENSPTRG00000024146   Transcript: ENSPTRT00000050427
Sequence length 549
Comment pep:novel chromosome:CHIMP2.1.4:14:74171102:74186359:-1 gene:ENSPTRG00000024146 transcript:ENSPTRT00000050427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVACECLPSPGLEPEPCSRARSQARVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLA
LERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERREAVKLKITKYLRRAEEIFNCHLQR
PLSSGASPSAGFSSLRLRPIRTLSSAVEQLRGCRVVGVIEKVQLVQDPATGGTFVVKSLP
RCHMVSRERLTIIPHGVPYMTKLLRYFVSEDSIFLHLEHVQGGTLWSHLLSQAHSRHSGL
SSGSTQERMKAQLNPHLNLLTPARLPSGHVPGQDRIALEPPRTSLNLLLAGEAPSTRPQR
EAEGEPTARTSTSGSSDLPKAPGGHLHLQARRAGQNSDAGPPRGLTWVPEGASPVLGGCG
RGMDQSCLSADGAGRGCGRATWSVREEQVKQWAAEMLVALEALHEQGVLCRDLHPGNLLL
DQAGHIRLTYFGQWSEVEPQCCGEAVDNLYSAPEVGGISELTEACDWWSFGSLLYELLTG
MALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHPFFS
TIHWSKLVG
Download sequence
Identical sequences ENSPTRP00000043096 ENSPTRP00000043096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]