SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043392 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043392
Domain Number 1 Region: 104-410
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-84
Family Protein kinases, catalytic subunit 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043392   Gene: ENSPTRG00000003331   Transcript: ENSPTRT00000050749
Sequence length 513
Comment pep:known chromosome:CHIMP2.1.4:11:8187748:8398294:-1 gene:ENSPTRG00000003331 transcript:ENSPTRT00000050749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSGLDKKSTKCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTSSIGSAESLISLERK
KEKNINRDITSRKDLPSRTSNVERKASQQQWGRGNFTEGKVPHIRIENGAAIQEIYTFGR
ILGKGSFGMVIEATDKETETKWAIKKVNKVKAGSSAVKLLEREVNILKSVKHEHIIHLEQ
VFETPKKMYLVMELCEDGELKEILDRKGHFSENETRWIIQSLASAIAYLHNNDIVHRDLK
LENIMKSSLIDDNIELTLNIKVTDFGLAVKKQSRSEAMLQATCGTPIYMAPEVISAHDYS
QQCDIWSIGVIMYMLLRGEPPFLASSEEKLFELIRKGELHFENPVWNSISDCAKSVLKQL
MKVDPAHRITAKELLDNQWLTGNKLSSVRPTNVLEMMKEWKNNPESVEENTTEEKNKPST
EEKLKSYQPWGNVRDANYTSDEEEEKQSTAYEKQFPATSKDNFDMCSSSFTSSKLLPAEI
KGEMEKTPVTPSQGTATKYPAKSGALSRTKKKL
Download sequence
Identical sequences ENSPTRP00000043392 ENSPTRP00000043392 9598.ENSPTRP00000043392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]