SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043439 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043439
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.4e-16
Family FHA domain 0.0022
Further Details:      
 
Domain Number 2 Region: 296-342
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000443
Family PHD domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043439   Gene: ENSPTRG00000017952   Transcript: ENSPTRT00000045450
Sequence length 345
Comment pep:known chromosome:CHIMP2.1.4:6:31511138:31516753:1 gene:ENSPTRG00000017952 transcript:ENSPTRT00000045450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCFQLLRIGGGRGGDLYTFHPPAGAGCTYRLGHRADLCDVALRPQQEPGLISGIHAEL
HAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM
FQQVRVKPQDFAAITIPRSRGEARVGAGFRPMLPSQGAPQRPLSTLSPAPKATLILNSIG
SLSKLRPQPLTFSPSWGGPKSLPVPAPPGEVGTTPSAPPQRNRRKSVHRVLAELDDESEP
PENPPPVLMERRKKLRVDKAPLTPTGNRRGRPRKYPVSAPVAPPAVGGGEPCAAPCCCLP
QEETVAWVQCDGCDVWFHVACVGCSIQAAREADFRCPGCRAGIQT
Download sequence
Identical sequences K7BC75 Q7YR48
9598.ENSPTRP00000043439 NP_001129081.1.37143 XP_003807381.1.60992 XP_003807382.1.60992 XP_009449065.1.37143 XP_009449066.1.37143 ENSPTRP00000043439 ENSPTRP00000043439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]