SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043665 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043665
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.74e-45
Family Cofilin-like 0.00000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043665   Gene: ENSPTRG00000023658   Transcript: ENSPTRT00000045338
Sequence length 154
Comment pep:known chromosome:CHIMP2.1.4:14:53425125:53436080:-1 gene:ENSPTRG00000023658 transcript:ENSPTRT00000045338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLGFFPYVNFCVSKVFMY
Download sequence
Identical sequences 9598.ENSPTRP00000044715 ENSPTRP00000044715 ENSPTRP00000043665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]