SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044072 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044072
Domain Number 1 Region: 175-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-77
Family Nuclear receptor ligand-binding domain 0.00000000156
Further Details:      
 
Domain Number 2 Region: 125-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044072   Gene: ENSPTRG00000023622   Transcript: ENSPTRT00000043883
Sequence length 458
Comment pep:known chromosome:CHIMP2.1.4:1:195672431:195898157:-1 gene:ENSPTRG00000023622 transcript:ENSPTRT00000043883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences A0A096NEC2 A0A0D9RT24 A0A287BBC6 A0A2J8V609 A0A2K5CDQ4 A0A2K5HGP7 A0A2K5ZZZ0 A0A2K6GGZ3 A0A2K6KDQ1 A0A2K6QJR9 A0A2K6U1A7 E2R7U1 F1D8R5 F6QHL4 G1RVM3 G3R425 G3SZB9 H2R2K0 I3MDN3 P62508 P62509 P62510 W5PNX1
ENSMUSP00000027906 ENSTTRP00000016500 ENSP00000386171 ENSOARP00000012147 ENSMUSP00000027906 ENSRNOP00000003489 ENSMUSP00000106563 ENSLAFP00000005905 ENSPTRP00000044072 ENSOCUP00000000851 ENSPTRP00000044072 10090.ENSMUSP00000027906 10116.ENSRNOP00000003489 9606.ENSP00000386171 9986.ENSOCUP00000018019 ENSPANP00000011239 ENSRNOP00000003489 ENSCAFP00000015853 ENSCJAP00000048948 ENSP00000386171 IGBMC-0018-000 IGBMC-0019-000 gi|45545433|ref|NP_001429.2| NP_001429.2.87134 NP_001429.2.92137 NP_036065.1.92730 XP_001489611.1.31192 XP_002693989.1.76553 XP_002717554.1.1745 XP_003265144.1.23891 XP_003814187.1.60992 XP_003930397.1.74449 XP_004013642.1.66739 XP_004028448.1.27298 XP_004271080.1.21590 XP_004312823.1.83887 XP_004375990.1.4749 XP_004410923.1.74151 XP_004439712.1.5094 XP_004578692.1.84141 XP_004699955.1.18182 XP_005348909.1.66349 XP_005981974.1.78601 XP_006076255.1.26621 XP_006155895.1.99106 XP_006250505.1.100692 XP_006869754.1.41390 XP_007126069.1.24612 XP_007950699.1.48129 XP_007986618.1.81039 XP_008519624.1.77740 XP_008578567.1.73410 XP_009235942.1.23681 XP_010364773.1.97406 XP_010597710.1.64505 XP_010851589.1.44457 XP_011230904.1.58354 XP_011784814.1.43180 XP_011842771.1.47321 XP_011996111.1.54773 XP_012315086.1.9421 XP_012520366.1.63892 XP_012601027.1.48125 XP_014705367.1.49734 XP_015864720.1.50099 XP_020760694.1.74333 XP_020919765.1.46622 XP_021053416.1.100879 XP_021510425.1.76796 XP_021588662.1.77405 XP_514199.2.37143 XP_849276.1.84170 XP_871260.1.59421 ENSCAFP00000037484 ENSTTRP00000005663 ENSCJAP00000027971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]