SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044216 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044216
Domain Number 1 Region: 68-407
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-81
Family Protein kinases, catalytic subunit 0.00000229
Further Details:      
 
Domain Number 2 Region: 876-927
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 943-1072
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000147
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000044216
Domain Number - Region: 1102-1162
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0484
Family Tricorn protease domain 2 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044216   Gene: ENSPTRG00000003849   Transcript: ENSPTRT00000046796
Sequence length 1551
Comment pep:known chromosome:CHIMP2.1.4:11:62751150:62771319:-1 gene:ENSPTRG00000003849 transcript:ENSPTRT00000046796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRLRALEQLARGEAGGCPGLDGLLDLLLALHHELSSGPLRRERSVAQFLSWASPFVSK
VKELRLQRDDFEILKVIGRGAFGEVTVVRQRDTGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTTLHYAFQDEEYLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDVNGHIRLADFGSCLRLNTNGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPPD
VPDVPASAQDLIRQLLCRQEERLGRGGLDDFRNHPFFEGVDWERLASSTAPYIPELRGPM
DTSNFDVDDDTLNHPGTLPPPSHGAFSGHHLPFVGFTYTSGSHSPESRSEAWAALERKLQ
CLEQEKVELSRKHQEALHAPTDHRELEQLRKEVQTLWDRLPEMLRDKASLSQTDGPPAGS
PGQDSDLRQELDRLHRELAEGRAGLQAQEQELCRAQGQQEELLQRLQEAQEREAATASQT
RALSSQLEEARAAQRELEAQVSSLSRQVTQLQGQWEQRLEESSQAKTIHTASETNGMGPP
EGGPQEAQLRKEVAALREQLEQAHSHRPSGKEEALCQLQEENRRLSREQERLEAELAQEQ
ESKQRLEGERRETESNWEAQLADILSWVNDEKVSRGYLQALATKMAEELESLRNVGTQTL
PARPLDHQWKARRLQKMEASARLELQSALEAEIRAKQGLQERLMQVQEAQLQAERRLQEA
EKQSQALQQELAMLREELRARGPVDTKPSNSLIPFLSFRSSEKDSAKDPGISGEATRHGG
EPDLRPEGQRSLRMGAVFPRAPTANTASTEGLPAKPGSHTLRPRSFPSPTKCLRCTSLML
GLGRQGLGCDACGYFCHTTCAPQAPPCPVPPDLLCTALGVHPETGTGTAYEGFLSVPRPS
GVRRGWQRVFAALSDSRLLLFDAPDPRLSPPSRALLQVLDLRDPQFSATPVLASDVIHAQ
SRDLPRIFRVTTSQLAVPPTTCTVLLLAESEGERERWLQVLGELQRLLLDVRPRPRPVYT
LKEAYDNGLPLLPHTLCAAILDQDRLALGTEEGLFVIHLRSNDIFQVGECRRVQQLTLSP
SAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQALAAGSILQARTPVLCVAVK
RQVLCYQLGPGPGPWQRRIRELQAPATVQSLGLLGDRLCVGAAGGFALYPLLNEAAPLAL
GAGLVPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGIYVDGAGRKSRGQELLWPAAPM
GWGYAAPYLTVFSENSIDVFDVRRAEWVQTVPLKKVRPLNPEGSLFLYGTEKVRLTYLRN
QLAEKDEFDIPDLTDNSRRQLFRTKSKRRFFFRVSEEQQKQQRREMLKDPFVRSKLISPP
TNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGG
DADPMKRKPWTSLSSESVSCPQGSLSPATSLMQVSERPRSLPLSPELESSP
Download sequence
Identical sequences H2R2M9
ENSPTRP00000044216 ENSPTRP00000044216 XP_001146567.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]