SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044222 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044222
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.23e-86
Family Nuclear receptor ligand-binding domain 0.000000000137
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044222   Gene: ENSPTRG00000018082   Transcript: ENSPTRT00000044524
Sequence length 441
Comment pep:known chromosome:CHIMP2.1.4:6:35785161:35871525:1 gene:ENSPTRG00000018082 transcript:ENSPTRT00000044524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences A0A096NHN6 A0A2K5MHE6 A0A2K5ZPZ7 H2R2N3
XP_007971033.1.81039 XP_007971034.1.81039 XP_007971035.1.81039 XP_009449385.1.37143 XP_011841943.1.47321 XP_011930909.1.92194 XP_011930919.1.92194 XP_011930930.1.92194 XP_016810794.1.37143 XP_016810795.1.37143 XP_016810796.1.37143 XP_518905.2.37143 9598.ENSPTRP00000044222 ENSPTRP00000044222 ENSPTRP00000044222 ENSPANP00000012484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]