SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045122 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045122
Domain Number 1 Region: 201-458
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-83
Family Nuclear receptor ligand-binding domain 0.000000000816
Further Details:      
 
Domain Number 2 Region: 132-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.48e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045122   Gene: ENSPTRG00000021527   Transcript: ENSPTRT00000039874
Sequence length 462
Comment pep:known chromosome:CHIMP2.1.4:9:133820909:133935571:1 gene:ENSPTRG00000021527 transcript:ENSPTRT00000039874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKHFLPLDFSAQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences H2R395
XP_016817526.1.37143 ENSPTRP00000045122 ENSPTRP00000045122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]