SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045176 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045176
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-35
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 2061-2202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000685
Family Extended AAA-ATPase domain 0.085
Further Details:      
 
Domain Number 3 Region: 2096-2131,2209-2325
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000193
Family Nucleotide and nucleoside kinases 0.089
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000045176
Domain Number - Region: 1630-1706
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 1877-1904
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0955
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045176   Gene: ENSPTRG00000003436   Transcript: ENSPTRT00000049537
Sequence length 2432
Comment pep:known chromosome:CHIMP2.1.4:11:19516432:19924329:1 gene:ENSPTRG00000003436 transcript:ENSPTRT00000049537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAILVASKMKSGLPKPVHSAAPILHVPPARAGPQPCYLKLGSKVEVSKTTYPSQIPLKS
QVLQGLQEPAGEGLPLRKSGSVENGFDTQIYTDWANHYLAKSGHKRLIKDLQQDVTDGVL
LAQIIQVVANEKIEDINGCPKNRSQMIENIDACLNFLAAKGINIQGLSAEEIRNGNLKAI
LGLFFSLSRFKQQQQQPQKQHLSSPLPPAVSQVAGAPSQCQAGTPQQQVPVTPQAPCQPH
QPAPHQQSKAQAEMQSRLPGPTARVSAAGSEAKTRGGSTTANNRRSQSFNNYDKSKPVTS
PPPPPSSHEKEPLASSASSHPGMSDNAPASLESGSSSTPTNCSTSSAIPQPGAATKPWRS
KSLSVKHSATVSMLSVKPPGPEAPRPTPEAMKPAPNNQKSMLEKLKLFNSKGGSKAGEGP
GSRDTSCERLETLPSFEESEELEAASRMLTTVGPASSSPKIALKGIAQRTFSRALTNKKS
SLKGNEKEKEKQQREKDKEKSKDLAKRASVTERLDLKEEPKEDPSGAAVPEMPKKSSKIA
SFIPKGGKLNSAKKEPMAPSHSGIPKPGMKSMPGKSPSAPAPSKEGERSRSGKLSSGLPQ
QKPQLDGRHSSSSSSLASSEGKGPGGTTLNHSISSQTVSGSVGTTQTTGSNTVSVQLPQP
QQQYNHPNTATVAPFLYRSQTDTEGNVTAESSSTGVSMEPSHFTKTGQPALEELTGEDPE
ARRLRTVKNIADLRQNLEETMSSLRGTQVTHSTLETTFDTNVTTEMSGRSILSLTGRPTP
LSWRLGQSSPRLQAGDAPSMGNGYPPRANASRFINTESGRYVYSAPLRRQLASRGSSVCH
VDVSDKAGDEMDLEGISLDAPGYMSDGDVLSKNIRTDDITSGYMTDGGLGLYTRRLNRLP
DGMAVVRETLQRNTSLGLGDADSWDDSSSVSSGISDTIDNLSTDDINTSSSISSYANTPA
SSRKNLDVQTDAEKHSQVERNSLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVSDESD
KSTSGKKNPVISQTGSWRRGMTAQVGITMPRTKPSAPAGALKTPGTGKTDDAKVSEKGRL
SPKASQVKRSPSDAGRSSGDESKKPLPSSSRTPTANANSFGFKKQSGSAAGLAMITASGV
TVTSRSATLGKIPKSSALVSRSAGRKSSMDGAQNQDDGYLALSSRTNLQYRSLPRPSKSN
SRNGAGNRSSTSSIDSNISSKSAGLPVPKLREPSKTALGSSLPGLVNQTDKEKGISSDNE
SVASCNSVKVNPAAQPVSSPAQTSLQPGAKYPDVASPTLRRLFGGKPTKQVPIATAENMK
NSVVISNPHATMTQQGNLDSPSGSGVLSSGSSSPLYSKNVDLNQSPLASSPSSAHSAPSN
SLTWGTNASSSSAVSKDGLGFQSISSLHTSCESIDISLSSGGVPSHNSSTGLIASSKDDS
LTPFVRTNSVKTTLSESPLSSPAASPKFCRSTLPRKQDSDPHLDRNTLPKKGLRYTPTSQ
LRTQEDAKEWLRSHSAGGLQDTAANSPFSSGSSVTSPSGTRFNFSQLASPTTVTQMSLSN
PTMLRTHSLSNADGQYDPYTDSRFRNSSMSLDEKSRTMSRSGSFRDGFEEVHGSSLSLVS
STSSIYSTPEEKCQSEIRKLRRELDASQEKVSALTTQLTANAHLVAAFEQSLGNMTIRLQ
SLTMTAEQKDSELNELRKTIELLKKQNAAAQAAINGVINTPELNCKGNGTAQSADLRIRR
QHSSDSVSSINSATSHSSVGSNIESDSKKKKRKNWYIQLRSSFKQAFGKKKSPKSASSHS
DIEEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEM
KLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISA
SPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPH
LFLIGCIGVSGKTKWDVLDGVVRRLFKEYIIHVDPVSQLGLNSDSVLGYSIGEIKRSNTS
ETPELLPCGYLVGENTTISVTVKGLAENSLDSLVFESLIPKPILQRYVSLLIEHRRIILS
GPSGTGKTYLANRLSEYIVLREGRELTDGVIATFNVDHKSSKELRQYLSNLADQCNSENN
AVDMPLVIILDNLHHVSSLGEIFNGLLNCKYHKCPYIIGTMNQATSSTPNLQLHHNFRWV
LCANHTEPVKGFLGRFLRRKLMETEISGRVRNMELVKIIDWIPKVWHHLNRFLEAHSSSD
VTIGPRLFLSCPIDVDGSRVWFTDLWNYSIIPYLLEAVREGLQLYGRRAPWEDPAKWVMD
TYPWAASPQQHEWPPLLQLRPEDVGFDGYSMPREGSTSKQMPPSDAEGDPLMNMLMRLQE
AANYSSPQSYDSDSNSNSHHDDILDSSLESTL
Download sequence
Identical sequences ENSPTRP00000045176 ENSPTRP00000045176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]