SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045350 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045350
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-29
Family FCH domain 0.0091
Further Details:      
 
Domain Number 2 Region: 431-513
Classification Level Classification E-value
Superfamily SH3-domain 2.06e-17
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 338-425
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000021
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045350   Gene: ENSPTRG00000023689   Transcript: ENSPTRT00000046182
Sequence length 574
Comment pep:known chromosome:CHIMP2.1.4:5:142388172:142398317:-1 gene:ENSPTRG00000023689 transcript:ENSPTRT00000046182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APREQVLRKGTENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSD
HGIFHSRTSLQKLSTKLSAQSAQYSQQLQAARNEYLLNLVATNAHLDHYYQEELPALLKA
LVSELSEHLRDPLTSLSRTELEAAEVILEHAHRGEQTTSQVSWEQDLKLFLQEPGVFSPT
PPQQFQPAGTDQVCVLEWGAEGVAGKSGLEKEVQRLTSRAARDYKIQNHGHRVLQRLEQR
RQQASEREASSIEQRLQEVRESIRRAQVSQVKGAARLALLQGAGLDVERWLKPAMTQAQD
EVEQERRLSEARLSQRDLSPTAEDAELSDFEECEETGELFEEPAPQALATRALPCPAHVV
FHYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEVGFVPERYLNFPDLSLPESSQ
DSDNPCGAEPTAFLAQALYSYTGQSAEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGRV
GVFPSLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTSVLDGPPAPVLPGDKALDF
PGFLDMMAPRLRPMRPPPPPPAKAPDPGHPDPLT
Download sequence
Identical sequences ENSPTRP00000045350 ENSPTRP00000045350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]