SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045665 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045665
Domain Number 1 Region: 215-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.31e-72
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 105-194
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-28
Family Nuclear receptor 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045665   Gene: ENSPTRG00000014697   Transcript: ENSPTRT00000044905
Sequence length 461
Comment pep:known chromosome:CHIMP2.1.4:3:24512657:24894629:-1 gene:ENSPTRG00000014697 transcript:ENSPTRT00000044905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences A0A2J8WZ26 F1D8N7 G1QTX5 G3S6W6 H2R3K3 P10828
NP_000452.2.87134 NP_000452.2.92137 NP_001121648.1.87134 NP_001121648.1.92137 NP_001121649.1.87134 NP_001121649.1.92137 NP_001239563.1.87134 NP_001239563.1.92137 XP_001164073.1.37143 XP_001164153.1.37143 XP_003256814.1.23891 XP_003256815.1.23891 XP_003256816.1.23891 XP_003826205.1.60992 XP_003826206.1.60992 XP_004033797.1.27298 XP_004087984.1.23891 XP_005265478.1.92137 XP_005265480.1.92137 XP_005265481.1.92137 XP_006713380.1.92137 XP_006713381.1.92137 XP_008949883.1.60992 XP_008949884.1.60992 XP_008949885.2.60992 XP_009443302.1.37143 XP_011532348.1.92137 XP_011532349.1.92137 XP_011532350.1.92137 XP_011532351.1.92137 XP_011532352.1.92137 XP_011532353.1.92137 XP_011532354.1.92137 XP_014199644.1.60992 XP_014199645.1.60992 XP_014199646.1.60992 XP_014199647.1.60992 XP_016796059.1.37143 XP_016796060.1.37143 XP_016796061.1.37143 XP_016796062.1.37143 XP_016796063.1.37143 XP_016796064.1.37143 XP_016796065.1.37143 XP_016796066.1.37143 XP_016796067.1.37143 XP_016796068.1.37143 XP_016796069.1.37143 XP_016796070.1.37143 XP_016796071.1.37143 XP_016796072.1.37143 XP_016796073.1.37143 XP_016862597.1.92137 XP_016862598.1.92137 XP_016862599.1.92137 XP_016862600.1.92137 XP_016862601.1.92137 XP_018878713.1.27298 XP_018878714.1.27298 XP_018878715.1.27298 XP_018878716.1.27298 XP_018878717.1.27298 ENSPTRP00000045665 gi|189491769|ref|NP_001121648.1| gi|189491771|ref|NP_001121649.1| gi|40806162|ref|NP_000452.2| ENSP00000348827 ENSP00000379904 ENSP00000414444 9606.ENSP00000348827 ENSNLEP00000004395 ENSNLEP00000004395 ENSP00000348827 ENSP00000379904 ENSP00000414444 ENSPTRP00000045665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]