SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000045837 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000045837
Domain Number 1 Region: 76-234,527-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.43e-78
Family Protein kinases, catalytic subunit 0.000000208
Further Details:      
 
Domain Number 2 Region: 34-44
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000107
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000045837   Gene: ENSPTRG00000019564   Transcript: ENSPTRT00000043759
Sequence length 696
Comment pep:known chromosome:CHIMP2.1.4:7:106605659:106883198:-1 gene:ENSPTRG00000019564 transcript:ENSPTRT00000043759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPVLAIQARKRRPKREKHPKKPEPQQKAPLVPPPPPPPPPPPPLPDPTPPEPEEEILGS
DDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVV
KSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHH
LLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRM
AAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEE
LEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKE
DAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPE
EYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLS
EGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLG
NACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDY
SRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWP
HEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS
Download sequence
Identical sequences ENSPTRP00000045837 ENSPTRP00000045837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]