SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046018 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046018
Domain Number 1 Region: 345-591
Classification Level Classification E-value
Superfamily BEACH domain 1.31e-73
Family BEACH domain 0.0000631
Further Details:      
 
Domain Number 2 Region: 1638-1939
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-35
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 215-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000038
Family Protein kinases, catalytic subunit 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000046018
Domain Number - Region: 809-833,873-1020,1145-1171
Classification Level Classification E-value
Superfamily ARM repeat 0.0391
Family HEAT repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046018   Gene: ENSPTRG00000008535   Transcript: ENSPTRT00000049817
Sequence length 1941
Comment pep:known chromosome:CHIMP2.1.4:17:1662775:1676439:1 gene:ENSPTRG00000008535 transcript:ENSPTRT00000049817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSGGREGALRTPAGGWHSPPSPDMQELLRSVERDLSIDPRQLAPAPGGTHVVALVPA
RWLASLRDRRLPLGPCPRAEGLGEAEVRTLLQRSVQRLPAGWTRVEVHGLRKRRLSYPLG
GGLPFEDGSCGPETLTRFMQEVAAQNYRNLWRHAYHTYGQPYSHSPAPSAVPALDSVRQA
LQRVYGCSFLPVGETTQCPSYAREAPCPPRGSPACPSLLRAEALLESPEMLYVVHPYVQF
SLHDVVTFSPAKLTNSQAKVLFILFRVLRAMDACHRQGLACGALSLYHIAVDEKLCSELR
LDLSAYERPEENENEEAPVARDEAGIASQEEQGGQPGQPTGQEELRSLVLDWVHGRISNF
HYLMQLNRLAGRRQGDPNYHPVLPWVVDFTTPHGRFRDLRKSKFRLNKGDKQLDFTYEMT
RQAFVAGGAGGGEPPHVPHHISDVLSDITYYVYKARRTPRSVLCGHVRAQWEPHEYPASM
ERMQNWTPDECIPEFYTDPSIFRSIHPDMPDLDVPAWCSSSQEFVAAHRALLESREVSRD
LHHWIDLTFGYKLQGKEAVKEKNVCLHLVDAHTHLASYGVVQLFDQPHPQRLAGAPALAP
EPPLIPKLLVQTIQETTGREDLTENPGQLPNGVGRPVLEATPCEASWTRDRPVAGEDDLE
QATEALDSISLAGKAGDQLGSSSQASPGLLSFSVASASRPGRRNKAAGADPGEGEEGRIL
LPEGFNPVQALEELEKTGNFLAKGLGGLLEVPEQPRVQPAVPLQCLLHRDMQALGVLLAE
MVFATRVRTLQPDAPLWVRFQAVRGLCTRHPKEVPVSLQPVLDTLLQLSGPEVPMGAERG
KLDQLFEYRPVSQGLPPPCPSQLLSPFSSVVPFPPYFPALHRFILLYQARRVEDKAQGRE
LVFALWQQLGAVLKDITPEGLEILLPFVLSLMSEEHTAVYTAWYLFEPVAKALGPKNANK
YLLKPLIGAYESPCQLHGRFYLYTDCFVAQLMVRLGLQAFLTHLLPHVLQVLAGAEASQE
ESKDLAGAAEEEESGLPRAGPGSCAFGEEIPMDGEPPASSGLGLPDYTSGVSFHDQADLP
ETEDFQAGLYVTESPQPQEAEAVSLGRLSDKSSTSETSLGEERAPDEGGAPVDKSSLRSG
DSSQDLKQSEGSEEEEEEEDSCVVLEEEEGEQEEVTGAPELTLSDTVLSMETVVASGSGG
DGEEEEEALPEQSEGKEQKILLDTACKMVRWLSAKLGPTVASRHVARNLLRLLTSCYVGP
TRQQFTVSSGESPPLSAGNIYQKRPVLGDIVSGPVLSCLLHIARLYGEPVLTYQYLPYIS
YLVAPGSASGPSRLNSRKEAGLLAAVTLTQKIIVYLSDTTLMDILPRISHEVLLPVLSFL
TSLVTGFPSGAQARTILCVKTISLIALICLRIGQEMVQQHLSEPVATFFQVFSQLHELRQ
QDLKLDPAGRGEGQLPQVVFSDGQQRSVDPALLDELQKVFTLEMAYTIYVPFSCLLGDII
RKIIPNHELVGELAALYLESISPSSRNPASVEPTVPSTGPEWDPQGGGCPQDDGHSGTFG
SVLVGNRIQIPNDSRPENPGPLGPISGVGGGGLGSGSDDNALKQELPRSVHGLSGNWLAY
WQYEIGVSQQDAHFHFHQIRLQSFPGHSGAVKCVAPLSGEDFFLSGSKDRTVRLWPLYNY
GDGTSETAPRLVYTQHRKSVFFVGQLEAPQHVVSCDGAVHVWDPFTGKTLRTVEPLDSRV
PLTAVAVMPAPHTSITMASSDSTLRFVDCRKPGLQHEFRLGGGLNPGLVRALAVSPSGRS
VVAGFSSGFMVLLDTRTGLVLRGWPAHEGDILQIKAVEGSVLVSSSSDHSLTVWKELEQK
PTHHYKSASDPIHTFDLYGSEVVTGTVSNKIGVCSLLEPPSQATTKLSSENFRGTLTSLA
LLPTKRHLLLGSDNGVIRLLA
Download sequence
Identical sequences ENSPTRP00000046018 ENSPTRP00000046018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]