SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046588 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046588
Domain Number 1 Region: 33-191,365-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-60
Family Protein kinases, catalytic subunit 0.000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046588   Gene: ENSPTRG00000022410   Transcript: ENSPTRT00000050889
Sequence length 532
Comment pep:known chromosome:CHIMP2.1.4:X:154476212:154480692:1 gene:ENSPTRG00000022410 transcript:ENSPTRT00000050889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALATPVPQMLQGFWGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTV
WLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRIS
GVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDI
KPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIGTKGPHGAGQTGKLSKNKRKKMRR
KRKQQKRLLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPAS
SSPAPGGGRSLSPGSQTSGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVN
PLEPQNADKIKIKIADLGNACWVVASVGEQSGYARPGCPVPRASSPPASSLTSSPFQAFE
LATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALSGRYSREFFNRRGELRHIHNL
KHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCLQHPWLNP
Download sequence
Identical sequences ENSPTRP00000046588 ENSPTRP00000046588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]