SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046790 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046790
Domain Number 1 Region: 49-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-70
Family Protein kinases, catalytic subunit 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046790   Gene: ENSPTRG00000008895   Transcript: ENSPTRT00000016398
Sequence length 347
Comment pep:known chromosome:CHIMP2.1.4:17:34666452:34697807:-1 gene:ENSPTRG00000008895 transcript:ENSPTRT00000016398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Download sequence
Identical sequences A0A096P364 A0A0D9R5N3 A0A2K5IJ40 A0A2K5YAG6 A0A2K6C303 A0A2K6L236 A0A2K6Q8E2 F6UE97 H2NT13 K7DT37 P46734 Q6FI23
ENSP00000345083 ENSMMUP00000035085 ENSP00000319139 gi|21618349|ref|NP_659731.1| ENSPTRP00000046790 ENSP00000345083 HR3022 ENSPPYP00000009080 NP_001252876.1.72884 NP_659731.1.87134 NP_659731.1.92137 XP_002827186.1.23681 XP_005583203.1.63531 XP_008008875.1.81039 XP_010382075.1.97406 XP_011759164.1.29376 XP_011817915.1.43180 XP_011856557.1.47321 XP_016803313.1.37143 XP_017716867.1.44346 ENSPPYP00000009080 9600.ENSPPYP00000009080 9606.ENSP00000345083 ENSPTRP00000046790 ENSPANP00000019789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]