SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000046968 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000046968
Domain Number 1 Region: 604-765
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.13e-29
Family Growth factor receptor domain 0.00067
Further Details:      
 
Domain Number 2 Region: 508-664
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.28e-29
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 3 Region: 902-1060
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.6e-27
Family Growth factor receptor domain 0.00077
Further Details:      
 
Domain Number 4 Region: 3038-3182
Classification Level Classification E-value
Superfamily CalX-like 4.84e-25
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 2552-2673
Classification Level Classification E-value
Superfamily CalX-like 5.62e-25
Family CalX-beta domain 0.00084
Further Details:      
 
Domain Number 6 Region: 2917-3039
Classification Level Classification E-value
Superfamily CalX-like 1.05e-23
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 7 Region: 805-962
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.77e-23
Family Growth factor receptor domain 0.0024
Further Details:      
 
Domain Number 8 Region: 2798-2913
Classification Level Classification E-value
Superfamily CalX-like 1.14e-19
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 9 Region: 421-524
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-18
Family Growth factor receptor domain 0.0012
Further Details:      
 
Domain Number 10 Region: 2673-2798
Classification Level Classification E-value
Superfamily CalX-like 7.72e-18
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 11 Region: 81-154
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000272
Family VWC domain 0.0096
Further Details:      
 
Domain Number 12 Region: 152-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.024
Further Details:      
 
Domain Number 13 Region: 219-280
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000942
Family VWC domain 0.019
Further Details:      
 
Domain Number 14 Region: 272-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000157
Family VWC domain 0.012
Further Details:      
 
Domain Number 15 Region: 26-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000711
Family VWC domain 0.004
Further Details:      
 
Domain Number 16 Region: 368-421
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000136
Family VWC domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000046968
Domain Number - Region: 1047-1096
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00643
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000046968   Gene: ENSPTRG00000016200   Transcript: ENSPTRT00000030153
Sequence length 4012
Comment pep:known chromosome:CHIMP2.1.4:4:51504301:51983704:-1 gene:ENSPTRG00000016200 transcript:ENSPTRT00000030153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLKVWLGLALALAEFAVLPHHSEGACVYQGSLLADATIWKPDSCQSCRCHGDIVICKP
AVCRNPQCAFEKGEVLQIAANQCCPECVLRTPGSCHHEKKIHEHGTEWASSPCSVCSCNH
GEVRCTPQPCPPLSCGHQELAFIPEGSCCPVCVGPGKPCSYEGHVFQDGEDWRLSRCAKC
LCRNGVVQCFTAQCQPLFCNQDETVVRVPGKCCPQCSARSCSAAGQVYEHGEQWSENACT
TCICDRGEVRCHKQACLPLRCGKGQSRARHHGQCCEECVSPAGSCSYDGVVRYQDEMWKG
SACEFCMCDHGQVTCQTGECAKVECAQGEELIHLHGKCCPECISRNGYCVYEETGEFMSS
NASEVKRIPEGEKWEDGPCKVCECRGAQVTCYEPSCPPCPVGTLALEAKGQCCPDCTSVH
CHPDCLTCSQSPDHCDLCQDPTKLLQNGWCVHSCGLGFYQAGSLCLACQPQCSTCTSGLE
CSSCQPPLLMRHGQCVPTCGDGFYQDRHSCAVCHESCAGCWGPTEKHCLACRDPLHVLRD
GGCESSCGKGFYNRQGTCSACDQSCDSCGPSSPRCLTCTEKTVLHDGKCMSECPGGYYAD
ATGRCKVCHNSCASCSGPTASHCTACSPPKALRQGHCLPRCGEGFYSDHGVCKACHSSCL
ACMGPAPSHCTGCKKPEEGLQVEQLSGAGIPSGECLAQCRAHFYLESTGICEACHQSCFR
CAGKSPHNCTDCGPSHVLLDGQCLSQCPDGYFHQEGSCTECHPTCRQCHGPLESDCISCY
PHISLTNGNCRTSCREEQFLNLVGYCADCHHLCQHCAADLHNTGSICLRCQNAHYLLLGD
HCVPDCPSGYYAERGACKKCHFSCRTCQGRGPFSCSSCDTNLVLSHTGTCSTTCFPGHYL
DDNHVCQPCNTHCGSCDSQASCTSCRDPNKVLLFGECQYESCAPQYYLDFSTNTCKECDW
SCSACSGPLKTDCLQCMDGYVLQEGACVEQCLSSFYQDSGLCKNCDSYCLQCQGPHECTR
CKGPFLLLEAQCVQECGKGYFADHAKHKCTACPWGCLQCSHRDRCHLCDHGFFLKSGLCV
YNCVPGFSVHTSNETCSGKIHTPSLHVNGSLILPIGSIKPLDFSLLNVQDQEGRVEDLLF
HVVSTPTNGQLVLSRNGKEVQLDKAGHFSWKDVNEKKVRFVHSKEKLRKGYFFLKISDQQ
FFSEPQLINIQAFSTQAPYVLRNEVLHISRGERATITTQLLDIRDDDNPQDVVIEIIDPP
LHGQLLQTLQSPAAPVYQFQLDELSRGLLHYAHDGSDSTSDVAVLQANDGHSFHNILFQV
KTVPQNDRGLQLVANSMVWVPEGGMLQITNRILQAEAPGASAEEIIYKITQDYPQFGEVV
LLVNMPADSPADEGQHLPDGRTATPTSTFTQQDINEGIVWYRHSGAPAQSDSFRFEVSSA
SNAQTRLESHMFNIAILPQTPEAPKVSLEASLHMTAREDGLTVIQPHSLSFINSEKPSGQ
IVYNITLPLHPNQGIIEHRDHPHSPIRYFTQEDINQGKVMYRPPLAAPHLQELMAFSFAG
LPESVKFHFTVSDGEHTSPEMVLTIHLLPSDQQLPVFQVTASRLAVSPGGSTSVGLQVVV
RDAETAPKELFFELRRPPQHGVLLKHTAEFRRPMATGDTFTYEDVEKNALQYIHDGSSTR
EDSMEISVTDGLTVTMLEVRVEVSLSEDRGPRLAAGSSLSITVASKSTAIITRSHLAYVD
DSSPDPEIWIQLNYLPSYGTLLRTSGSEVEELSEVSNFTMEDINNKKIRYSAVFETDGHL
VTDSFYFSVSDMDHNHLDNQIFTIMITPAENPPPVIAFADLITVDEGGRAPLSFHHFFAT
DDDDNLQRDAIIKLSALPKYGCIENTGTGDRFGPETASDLEASFPIQDVLENYIYYFQSV
HESIEPTHDIFSFYVSDGTSRSEIHSINITIERKNDEPPRMTLQPLRVQLSSGVVISNSS
LSLQDLDTPDNELIFVLTKKPDHGHVLWRQTASEPLENGRVLVQGSTFTYQDILAGLVGY
VPSVPGMVVDEFQFSLTDGLHVDTGRMKIYTELPASDTPHLAINQGLQLSAGSVARITEQ
HLKVTDIDSDDHQVMYIMKEDPGAGHLQMMKHGNLEQISIKGPIRSFTQADISQGHVEYS
HGTGEPGGSFAFKFDVVDGEGNRLIDKSFSISVLEDKSPPVIITNKGLVLDENSVKKITT
LQLSATDQDSGPTELIYRITRQPQLGHLEHATSPGIQISSFTQADLTSRNVQYVHSSEAE
KHSDAFSFTLSDGVNEVTQTFHITLHPVDDSLPVIQNLGMQVQEGMRKTITEFELKAVDA
DTEAESVTFTIVQPPRHGTIERTSNGQHFHLTSTFTMEDIYQNRVSYSHDGSNSLKDRFT
FTVSDGTNPFFIIEEGGKEIMTAAPQPFRVDILPVDDGTPRIVTNLGLQWLEYMDGKATN
LITKKELLTMDPDTEDAQLVYEITTGPKHGFVENKLQPGRAAATFTQEDVNLGLIRYVLH
KEKIREMMDSFQFLVKDSKPNVVSDNVFHIQWSLISFKYTSYNVSEKAGSVSVTVQRTGN
LNQYAIVLCRTEQGTASSSSRVSSQPGQQDYVEYAGQVQFDEREDTKSCTIVINDDDVFE
NVESFTVELSMPAYALLGEFTQAKVIINDTEDEPTLEFDKKIYRVNESAGFLFAPIERKG
DASSIVSAICYTVPKSAMGSSLYALESGSDFKSRGMSAASRVIFRPGVTMSTCDVMLIDD
SEYEEEEEFEIALADASDNARIGRVATAKVLISGPNDASTVSLGNTAFTVSEDAGTVKIP
VIRHGTDLSTFTSVWCATRPSDPASATPGVDYVPSSRKVEFGPGVIEQYCTLTILDDTQY
PVIEGLETFVVFLSSAQGAELTKPFQAVIAINDTFQDVPSMQFAKDLLLVKEKEGVLHVP
ITRSGDLSYESSVRCYTQSHSAQVMEDFEERQNADSSRITFLKGDKVKNCTVYIHDDSMF
EPEEQFRVYLGLPLGNHWSGARIGKNNMATITISNDEDAPTIEFEEAAYQVREPAGPDAI
AILNIKVIRRGDQNRTSKVRCSTRDGSAQSGVDYYPKSRVLKFSPGVDHIFFKVEILSNE
DREWHESFSLVLGPDDPVEAVLGDVTTATVTILDQEAAGSLILPAPPIVVTLADYDHVEE
VTKEGVKKSPSPGYPLVCVTPCDPHFPRYAVMKERCSEAGINQTSVQFSWEVAAPTDGNG
ARSPFETITDNTPFTSVNHMVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNIVTIGTD
SAICHTPVVAGTSRGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPL
HNLHFLLSESIYRHQHVCSNLVTTYDLRGISEAGFLDDVVYDSTALGPGYDRPFQFDPSV
REPKTIQLYKHLNLKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYV
SYIYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVI
EFKTHAKFRGQFVMEHHTLPDVKSFILTPDHLGGIEFDLQLLWSAQTFDSPHQLWRATSS
YNRKDYSGEYTIYLIPCTVQPTQPWVDPGEKPLACTAHAPERFLIPIAFQQTNRPVPVVY
SLNTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQ
LEKVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRNQPEVTDKYFHD
VPFEAHFASELPDFHVVSNMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDTISGPRV
QRSLTAPLRRNRRDLVEPNGQLILDDSLIYDNEGDQVKNGTNMKSLNLEMQELAVAASLS
QTGASIGSALAAIMLLLLVFLVACFINRKCQKQRKKKPAEDILEEYPLNTKVEVPKRHPD
RVEKNVNRQYCTVRNVNILSEPEAAYTFKGAKVKRLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences ENSPTRP00000046968 ENSPTRP00000046968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]