SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047264 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047264
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-25
Family Canonical RBD 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047264   Gene: ENSPTRG00000022269   Transcript: ENSPTRT00000041522
Sequence length 284
Comment pep:known chromosome:CHIMP2.1.4:X:130985835:130993973:1 gene:ENSPTRG00000022269 transcript:ENSPTRT00000041522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFN
GIKIKGRTIRVDHVSNYRAPKDSEEMDDVTRQLQEKGCGARTPSPSLSESSEDEKPTKKH
KKDKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQNSEP
REGQKLPKSRTAYSGGAEDLERELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSS
WYNGRSEGRSYRSRSRSRDKSHRHKRARRSRERESSNPSDRWRH
Download sequence
Identical sequences ENSPTRP00000047264 ENSPTRP00000047264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]