SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048301 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048301
Domain Number 1 Region: 883-1010,1042-1247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-80
Family p120GAP domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 33-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1477-1575
Classification Level Classification E-value
Superfamily RGC domain-like 4.05e-34
Family RGC domain 0.00000979
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048301
Domain Number - Region: 689-750
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.031
Further Details:      
 
Domain Number - Region: 594-626
Classification Level Classification E-value
Superfamily WW domain 0.00325
Family WW domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048301   Gene: ENSPTRG00000017002   Transcript: ENSPTRT00000031522
Sequence length 1575
Comment pep:known chromosome:CHIMP2.1.4:5:38837597:39145604:-1 gene:ENSPTRG00000017002 transcript:ENSPTRT00000031522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELP
PTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAM
ESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAVEKGIAEQTVVTLRNP
NAVLTLVDDNLAPEYQKELWDAKKKKEENARLKNSCISEEERDAYEELLTQAEIQGNINK
VNRQAAVDHINAVIPEGDPENTLLALKKQEAQLPAVYPFAAAMYQNELFNLQKQNTMNYL
AHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLLSVK
LEVLSQGQDNLSWNEIQNCIDMVNAQIQEENDRVVAVGYINEAIDEGNPLRTLETLLLPT
ANISDVDPAHAQHYQDVLYHAKSQKLRDSESVSKVLWLDEIQQAVDEANVDEDRAKQWVT
LVVDVNQCLEGKKSSDILSVLKSSTSNANDIIPECADKYYDALVKAKELKSERVSSDGSW
LKLNLHEKYDYYYNIDSKESSWVTPESCLYKESWLTGKEIEDIIEEVTVGYIRENIWSAS
EELLLRFQATSSGPILREEFEARKSFLHEQEENVVKIQAFWKGYKQRKEYMHRRQTFIDN
TDSIVKIQSWFRMATARKSYLSRLQYFRDHNNEIVKIQSLLRANKARDDYKTLVGSENPP
LTVIRKFVYLLDQSDLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHSKKLNKKKGGEMEILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPLYLA
KLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTG
NPTVIKMVVSFNRGARGQNTLRQLLAPVVKEIIDDKSLIINTNPVEVYKAWVNQLETQTG
EASKLPYDVTTEQALTYPEVKNKLEASIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVL
KNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINSDQRRNLGS
VAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEEKFNMDKYTDL
VTVSKPVIYISIEEIISTHSLLLEHQDAIAPEKNDLLSELLGSLGEVPTVESFLGEGAVD
PNDPNKANTLSQLSKTEISLVLTSKYDIEDGEAIDSRSLMIKTKKLIIDVIRNQPGNTLT
EILETPATAQQEVDHATDMVSRAMIDSRTPEEMKHSQSMIEDAQLPLEQKKRKIQRNLRT
LEQTGHVSSENKYQDILNEIAKDIRNQRIYRKLRKAELAKLQQTLNALNKKAAFYEEQIN
YYDTYIKTCLDNLKRKNTRRSIKLDGKGEPKGAKRAKPVKYTAAKLHEKGVLLDIDDLQT
NQFKNVTFDIIATEDVGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVN
VNLLIYLLNKKFYGK
Download sequence
Identical sequences A0A2I3TWS1
ENSPTRP00000048301 ENSPTRP00000048301 XP_001146396.1.37143 9598.ENSPTRP00000048301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]