SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048447 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048447
Domain Number 1 Region: 191-238
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1280-1337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000824
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 627-691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000366
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 1028-1087
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 357-410
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000106
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 768-821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 7 Region: 694-763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 8 Region: 1411-1466
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 1086-1156
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000111
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 1335-1385
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000112
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 11 Region: 1162-1212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 12 Region: 899-954
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000706
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 13 Region: 417-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000889
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000048447
Domain Number - Region: 1215-1270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000497
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 505-570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00327
Family TSP-1 type 1 repeat 0.009
Further Details:      
 
Domain Number - Region: 960-1027
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0209
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048447   Gene: ENSPTRG00000018936   Transcript: ENSPTRT00000042394
Sequence length 1654
Comment pep:known chromosome:CHIMP2.1.4:7:9983051:10422500:-1 gene:ENSPTRG00000018936 transcript:ENSPTRT00000042394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQARRWASGSRGAAGPRRGVLQLLPLPLLLLLLLLRPGAGRAAAQGEAEAPTLYLWKT
GPWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELYD
WRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPLL
EQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQS
SPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELIKKK
RNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSCVITKECQV
SEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQFPIGSEKECPEFEEKEPCLSQGDGVVPCA
TYGWRTTEWTECRVDPLLSQQDKRRGNQTALCGGGIQTREVYCVQANENLLSQLSTHKNK
EASKPMDLKLCTGPIPNTTQLCHIPCPTECEVSPWSAWGPCTYENCNDQQGKKGFKLRKR
RITNEPTGGSGVTGNCPHLLEAIPCEEPACYDWKAVRLGDCEPDNGKECGPGTQVQEVVC
INSDGEEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRAR
SILAYAGEEGGIRCPNSSALQEVRSCNEHPCTVYHWQTGPWGQCIEDTSVSSFNTTTTWN
GEASCSVGMQTRKVICVRVNVGQVGPKKCPESLRPETVRPCLLPCKKDCIVTPYSDWTSC
PSSCKEGDSSIRKQSRHRVIIQLPANGGRDCTDLLYEEKACEAPQACQSYRWKTHKWRRC
QLVPWSVQQDSPGAQEGCGPGRQARAITCRKQDGGQAGIHECLQYAGPVPALTQACQIPC
QDDCQLTSWSKFSSCNGDCGAVRTRKRTLVGKSKKKEKCKNSHLYPLIETQYCPCDKYNA
QPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSHGY
IEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVNQFQ
VYEVVPCHSDCNQYLWVTEPWSICKVTFVNMRENCGEGVQTRKVRCMQNTADGPSEHVED
YLCDPEEMPLGSRVCKLPCPEDCVISEWGPWTRCVLPCNQSSFRQRSADPIRQPADEGRS
CPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLSEKAVCGNGIKTRMLDCVRSDGKSVDLKY
CEALGLEKNWQMNTSCMVECPVNCQLSDWSPWSECSQTCGLTGKMIRRRTVTQPFQGDGR
PCPSLMDQSKPCPVKPCYRWQYGQWSPCQVQEAQCGEGTRTRNISCVVSDGSADDFSKVV
DEEFCADMELIIDGNKNMVLEESCTQPCPGDCYLKDWSSWSLCQLTCVNGEDLGFGGIQV
RSRPVIIQELENQHLCPEQMLETKSCYDGQCYEYKWMASAWKGSSRTVWCQRSDGINVTG
GCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYTEVMSSNSTLEQCTLIPVVVLPT
MEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPDGRLKTWVYGVAAGAFVLLIFIV
SMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences 9598.ENSPTRP00000048447 ENSPTRP00000048447 ENSPTRP00000048447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]