SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048659 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000048659
Domain Number - Region: 42-110
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0732
Family Extracellular domain of cell surface receptors 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048659   Gene: ENSPTRG00000028993   Transcript: ENSPTRT00000056025
Sequence length 163
Comment pep:novel chromosome:CHIMP2.1.4:19:48509647:48515230:1 gene:ENSPTRG00000028993 transcript:ENSPTRT00000056025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVLLLALLGVTLPLPGVQALFCQLGTNHRVWKVSDLPRQWTPKNTSCDSGLGCQDTLM
LIESGPVSMVLSGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRPEDFCNNLVNSLPLWAP
QPAGFLQLKPVGLLEEHNVGGKGSSQGQHQQLGQQKRATTGIF
Download sequence
Identical sequences ENSPTRP00000048659 ENSPTRP00000048659 9598.ENSPTRP00000048659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]