SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048737 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048737
Domain Number 1 Region: 168-326
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-39
Family Protein kinases, catalytic subunit 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048737   Gene: ENSPTRG00000006915   Transcript: ENSPTRT00000056088
Sequence length 335
Comment pep:novel chromosome:CHIMP2.1.4:19:44398396:44404735:1 gene:ENSPTRG00000006915 transcript:ENSPTRT00000056088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIVRGNKSAEGGGPRFIREKRPLSGQEVGTPQPAGLASGGKLAAGRPFTYPRDDHPSRGA
QGEPHDVAPNGPSAGGLAIPQSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARTPAAP
AAPAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIA
TVRSWGKLVAVKNMDLRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEV
DIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRD
PAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
Download sequence
Identical sequences ENSPTRP00000048737 ENSPTRP00000048737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]