SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048862 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048862
Domain Number 1 Region: 11-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-73
Family Protein kinases, catalytic subunit 0.0000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048862   Gene: ENSPTRG00000010740   Transcript: ENSPTRT00000056197
Sequence length 273
Comment pep:known chromosome:CHIMP2.1.4:19:19838908:19842506:-1 gene:ENSPTRG00000010740 transcript:ENSPTRT00000056197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDFVNKFLPRE
LSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQAVQRSGRIPGVQARDLFAQIA
GAVRYLHDHHLVHRDLKCENVLLSPDERRVKLTDFGFGRQAHGYPDLSTTYCGSAAYASP
EVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERC
KALIAELLQFSPSARPSAGQVARNCWLRAGDSG
Download sequence
Identical sequences H2R688
XP_008969224.1.60992 XP_009433374.1.37143 XP_016792565.1.37143 ENSPTRP00000048862 ENSPTRP00000048862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]