SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048957 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048957
Domain Number 1 Region: 611-922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-90
Family Protein kinases, catalytic subunit 0.0000000488
Further Details:      
 
Domain Number 2 Region: 125-196
Classification Level Classification E-value
Superfamily HR1 repeat 1.31e-23
Family HR1 repeat 0.000018
Further Details:      
 
Domain Number 3 Region: 209-284
Classification Level Classification E-value
Superfamily HR1 repeat 3.53e-23
Family HR1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 19-97
Classification Level Classification E-value
Superfamily HR1 repeat 3.27e-20
Family HR1 repeat 0.00000822
Further Details:      
 
Domain Number 5 Region: 321-337,388-478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000141
Family PLC-like (P variant) 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048957   Gene: ENSPTRG00000010591   Transcript: ENSPTRT00000019528
Sequence length 941
Comment pep:known chromosome:CHIMP2.1.4:19:14728820:14769235:1 gene:ENSPTRG00000010591 transcript:ENSPTRT00000019528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLR
RATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAAAHDGPQSPGAGGPTC
SATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQAGQLENQAAPDDTQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLS
AAKAPDRKAVTEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF
STRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGGPGTPDSRPPF
LSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV
IERIPRLRRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGS
EARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPLQESTAPELPSETRETPGPA
LCSRLRKSLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLM
CEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYS
ACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEF
LAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAE
AIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTVSGRTDV
SNFDEEFTGEAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC
Download sequence
Identical sequences 9598.ENSPTRP00000048957 ENSPTRP00000048957 ENSPTRP00000048957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]