SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049016 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049016
Domain Number 1 Region: 817-1102
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-70
Family Protein kinases, catalytic subunit 0.00000836
Further Details:      
 
Domain Number 2 Region: 512-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-44
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 388-489,518-543
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000157
Family SH2 domain 0.0058
Further Details:      
 
Domain Number 4 Region: 312-373
Classification Level Classification E-value
Superfamily PH domain-like 0.000000443
Family Third domain of FERM 0.022
Further Details:      
 
Domain Number 5 Region: 77-202
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000105
Family Second domain of FERM 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049016   Gene: ENSPTRG00000010468   Transcript: ENSPTRT00000019274
Sequence length 1123
Comment pep:known chromosome:CHIMP2.1.4:19:10544792:10562714:-1 gene:ENSPTRG00000010468 transcript:ENSPTRT00000019274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYR
CGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSSEEEIHHFKNESL
GMAFLHLCHLALRHGIPLQEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRD
FQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAPTDPG
PESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQ
PADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLVDGYF
RLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLI
LTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSIRELGAALQGCLLRAGDDC
FSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTRTNVY
EGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETASLMSQ
VSHMHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLASALSY
LENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLAPECL
PVGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPELATL
TSQCLTYEPTQRPSFRTILRDLTRLQPHNLAPFWTVNPDSPASDPTVFHKRYLKKIRDLG
EGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKG
CCEDQGEKSLQLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDL
AARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDV
WSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEV
YHLMKNCWETEASFRPNFENLIPILKTVHEKYQGQAPSVFSVC
Download sequence
Identical sequences ENSPTRP00000049016 ENSPTRP00000049016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]