SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049076 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049076
Domain Number 1 Region: 572-862
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-84
Family Protein kinases, catalytic subunit 0.0000000000452
Further Details:      
 
Domain Number 2 Region: 120-210
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-24
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 29-127
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 205-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000242
Family I set domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049076
Domain Number - Region: 345-409
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000432
Family Frizzled cysteine-rich domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049076   Gene: ENSPTRG00000021248   Transcript: ENSPTRT00000056357
Sequence length 875
Comment pep:known chromosome:CHIMP2.1.4:9:109602206:109731342:1 gene:ENSPTRG00000021248 transcript:ENSPTRT00000056357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRELVNIPLVHILTLVAFSGTEKLPKAPVITTPLETVDALVEEVATFMCAVESYPQPEIS
WTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMK
PKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNV
QKEDAGQYRCVAKNSLGTAYSKVVKLEVEVFARILRAPESHNVTFGSFVTLHCTATGIPV
PTITWIENGNAVSSGSIEESVKDRVIDSRLQLFITKPGLYTCIATNKHGEKFSTAKAAAT
ISIAEMLFISSFSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHT
AWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLAVKELFCAKEWLAME
EKTHRGLYRSEMHLLSVPECSKLPSMHWDPTACARLPHLDYNKENLKTFPPMTSSKPSVD
IPNLPSSSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYCCRRRKQWKNKKRESAAV
TLTTLPSELLLDRLHPNPMYQRMPLLLNPKLLSLEYPRNNIEYVRDIGEGAFGRVFQARA
PGLLPYEPFTMVAVKMLKEEASADMQADFQREAALMAEFDNPNIVKLLGVCAVGKPMCLL
FEYMAYGDLNEFLRSMSPHTVCSLSHSDLSMRAQVSSPGPPPLSCAEQLCIARQVAAGMA
YLSERKFVHRDLATRNCLVGENMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESI
FYNRYTTESDVWAYGVVLWEIFSYGLQPYYGMAHEEVIYYVRDGNILSCPENCPVELYNL
MRLCWSKLPADRPSFTSIHRILERMCERAEGTVSV
Download sequence
Identical sequences 9598.ENSPTRP00000049076 ENSPTRP00000049076 ENSPTRP00000049076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]