SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049156 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049156
Domain Number 1 Region: 179-226
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 1249-1299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 597-660
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 996-1044
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 336-389
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 1055-1124
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 664-732
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 8 Region: 1369-1433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 737-789
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 1130-1178
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 11 Region: 921-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 12 Region: 1302-1356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049156
Domain Number - Region: 1182-1232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000105
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number - Region: 795-865
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000209
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number - Region: 42-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000379
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number - Region: 867-921
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00101
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number - Region: 102-174
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.016
Further Details:      
 
Domain Number - Region: 397-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00327
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number - Region: 480-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0034
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049156   Gene: ENSPTRG00000012502   Transcript: ENSPTRT00000023194
Sequence length 1609
Comment pep:known chromosome:CHIMP2.1.4:2B:140854123:141671882:1 gene:ENSPTRG00000012502 transcript:ENSPTRT00000023194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPKSNLTVTCWVWRSMRKLFLLLSLLLSHAAHLEGKKDNQFIWKPGPWGRCTGDCGPGG
VQSRAVWCFHVDGWTSHLSNCGESNRPPKERSCFRVCDWHSDLFQWEVSDWHHCVLVPYA
RGEVKPRIAECVTAQHGLQHRMVRCIQKLNRTVVANEICEHFAPQPPTEQACLIPCPRDC
VVSEFLPWSNCSKGCGKKLQHRTRAVIAPPLFGGLQCPNLTESRACDASISCPLGEEEYT
FSLKVGPWSKCRLPHLKEINPSGRTVLDFNSDSNERVTFKHQSYKAHHHSKSWAIEIGYQ
TRQVSCTRSDGQNAMLSLCLQDSFPLTVQSCIMPKDCETSQWSSWSPCSKTCRSGSLLPG
FRSRSRNVKHMAIGGGKECPELLEKEACIVEGELRQQCPRYSWRTSEWKECQVSLLLEQQ
DPHWHVTGPVCGGGIQTREVYCAQSVPAAAALRAKEVSRPVEKTLCMGPTPLPSQLCNIP
CSTDCIVSSWSAWGLCIHENCRDPQGKKGFRTRQRHVLMESTGPAGHCPHLVESVPCEDP
MCYRWLASEGICFPDHGKCGLGHRILKAVCQNDRGEDVSGSLCPVPPPPERKACEIPCRM
DCVLSEWTEWSSCSQSCSNKNSDGKQTRSRTILALAGEGGKPCPPSQALQEHRLCNDHSC
MQLHWETSPWGPCSEDTLVTALNATIGWNGEATCGVGIQTRRVFCVKSHVGQVMTKRCPD
STRPETVRPCFLPCKKDCIVTAFSEWTPCPRMCQAGNATVKQSRYRIIIQEAANGGQECP
DTLYEERECEDVSLCPVYRWKPQKWSPCILVPESVWQGITGSSEACGKGLQTRAVSCISD
DNRSAEMMECLKQTNGMPLLVQECTVPCREDCTFTAWSKFTPCSTNCEATKSRRRQLTGK
SRKKEKCQDADLYPLVETELCPCDEFISQPYGNWSDCILPEGRREPHRGLRVQGDSKECG
EGLRFRAVACSDKNGRPVDPSFCSSSGYIQEKCVIPCPFDCKLSDWSSWGSCSSSCGIGV
RIRSKWLKEKPYNGGRPCPKLDLKNQNAQVHEAVPCYSECNQYSWVVEHWSSCKINNELR
SLRCGGGTQSRKIRCVNTADGEGGAVDSNLCNQDEIPPETQSCSLMCPNECVMSEWGLWS
KCPQSCDPHTMQRRTRHLLRPSLNSRTCAEDSQVQPCLLNENCFQFQYNLTEWSTCQLSE
NAPCGQGVRTRLLSCVRSDGKPVSVDQCEQHNLEKPQRMSIPCLVECVVNCQLSGWTAWT
ECSQTCGHGGRMSRTRFIIMPTQGEGRPCPTELTQQKTCPVTPCYSWVLGNWSACKLEGG
DCGEGVQIRSLSCMVHNGSISHAAGRVEDALCGEMPFQDSILKQLCSVPCPGDCHLTEWS
EWSTCELTCIDGRSFETVGRQSRSRTFIIQSFENQDSCPQQVLETRPCTGGKCYHYTWKA
SLWNNNERTVWCQRSDGVNVTGGCSPQARPAAIRQCIPACRKPFSYCTQGGVCGCEKGYT
EIMRSNGFLDYCMKVPGSEDKKADVKNLSGKNRPVNSKIHDIFKGWSLQPLDPDGRVKIW
VYGVSGGAFLIMIFLIFTSYLVCKKPKPHQSTPPQQKPLTLAYDGDLDM
Download sequence
Identical sequences ENSPTRP00000049156 ENSPTRP00000049156 9598.ENSPTRP00000049156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]