SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049172 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049172
Domain Number 1 Region: 280-499
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.3e-30
Family Arfaptin, Rac-binding fragment 0.063
Further Details:      
 
Domain Number 2 Region: 666-805
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-24
Family BCR-homology GTPase activation domain (BH-domain) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049172   Gene: ENSPTRG00000010180   Transcript: ENSPTRT00000018693
Sequence length 964
Comment pep:novel chromosome:CHIMP2.1.4:19:1009103:1028880:1 gene:ENSPTRG00000010180 transcript:ENSPTRT00000018693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPASGSSGVKATG
TLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLL
ADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAA
GTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSS
QSMESLYGPGSEGTPPSLDDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHGMVQAVGT
LQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLAEEAMATYRTCVADAKTQKQELEDT
KVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASH
VRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGT
PAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSGTMSSTEELVDPDG
GAGASSFEQADLNGMTPELPVAVPSGPFRHKGLSKAAHTHRLRKLRTLAKCLECNNYIYF
QSADYEDLPEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESQAVAVAMAGRLR
ELLRDLPPENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSS
LVDYPHQARVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEAGEAVVYPL
QEAAEDGCRESRVVSNDSDSDLEEASELLSSSEASALGRLSFLEQQQSEASLEAASGSHS
GSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQTPLPPMRLRGGRMTLGSCRERQ
PEFV
Download sequence
Identical sequences 9598.ENSPTRP00000049172 ENSPTRP00000049172 ENSPTRP00000049172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]