SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049283 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000049283
Domain Number - Region: 78-160
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00159
Family Snake venom toxins 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049283   Gene: ENSPTRG00000029245   Transcript: ENSPTRT00000056528
Sequence length 161
Comment pep:known chromosome:CHIMP2.1.4:9:70603852:70613694:-1 gene:ENSPTRG00000029245 transcript:ENSPTRT00000056528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKIEISGTSLSFHLLFGLEIRMRRIVFAGVILFRLLGVILLRLLGVILFGRLGDLGTCQ
TKPGQYWKEEVHIQDVGGLICRACNLSLPFHGCLLDLGTCQAEPGQYCKEEVHVQGGIQW
YSVKGCTKNTSECFKSTLVKRILQLHELVTTYCCNHSLCNF
Download sequence
Identical sequences H2R6N0
ENSPTRP00000049283 XP_001147565.2.37143 9598.ENSPTRP00000049283 ENSPTRP00000049283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]