SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049400 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049400
Domain Number 1 Region: 538-883
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-87
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000609
Further Details:      
 
Domain Number 2 Region: 266-410,473-520
Classification Level Classification E-value
Superfamily ARM repeat 1.96e-65
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00028
Further Details:      
 
Domain Number 3 Region: 36-166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.47e-41
Family PLC-like (P variant) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049400   Gene: ENSPTRG00000009983   Transcript: ENSPTRT00000018326
Sequence length 887
Comment pep:known chromosome:CHIMP2.1.4:18:37792080:37919180:1 gene:ENSPTRG00000009983 transcript:ENSPTRT00000018326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
Download sequence
Identical sequences A0A2I2ZRM9 A0A2I3SV31 Q8NEB9
ENSPTRP00000049400 ENSPTRP00000049400 gi|34761064|ref|NP_002638.2| 9606.ENSP00000262039 ENSP00000262039 NP_002638.2.87134 NP_002638.2.92137 XP_001142812.1.37143 XP_003830260.1.60992 XP_004059400.2.27298 ENSP00000262039 ENSP00000262039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]