SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049510 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049510
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 1.27e-48
Family YWTD domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000367
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 9 Region: 360-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000873
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 357-434,701-751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049510   Gene: ENSPTRG00000020732   Transcript: ENSPTRT00000042429
Sequence length 873
Comment pep:known chromosome:CHIMP2.1.4:9:2631960:2665929:1 gene:ENSPTRG00000020732 transcript:ENSPTRT00000042429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRINEISC
GAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHIKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQINDHSPKYTCSCPNGYNVEENGRDCQSTATTVTYSETKDTNTTEISPTSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences A0A2I3RFS4
ENSPTRP00000049510 9598.ENSPTRP00000049510 ENSPTRP00000049510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]