SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049774 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049774
Domain Number 1 Region: 167-503
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.47e-86
Family Protein kinases, catalytic subunit 0.0000000000122
Further Details:      
 
Domain Number 2 Region: 10-164
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.59e-43
Family Regulator of G-protein signaling, RGS 0.000000262
Further Details:      
 
Domain Number 3 Region: 534-643
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-24
Family Pleckstrin-homology domain (PH domain) 0.00000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049774   Gene: ENSPTRG00000014187   Transcript: ENSPTRT00000026501
Sequence length 668
Comment pep:known chromosome:CHIMP2.1.4:22:24210898:24371972:1 gene:ENSPTRG00000014187 transcript:ENSPTRT00000026501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KATPAARASKRIVLPEPNIRSVMQKYLAERNEITFDKIFNQKIGFLLFKDFCLNEINEAV
PQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQ
VTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRG
GFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYA
FHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKP
ANILLDEHGHARISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSADWFSLGCM
LFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPELKSLLEGLLQRDVSKRLGCH
GGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLD
CDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCI
LFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSL
CHRNSNGL
Download sequence
Identical sequences ENSPTRP00000049774 ENSPTRP00000049774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]