SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049946 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049946
Domain Number 1 Region: 2198-2292
Classification Level Classification E-value
Superfamily C-type lectin-like 2.35e-31
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1573-1727
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-29
Family FAS1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 978-1129
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-28
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 525-655
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-24
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1742-1882
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-23
Family FAS1 domain 0.0034
Further Details:      
 
Domain Number 6 Region: 1144-1265
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-21
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 7 Region: 2288-2449
Classification Level Classification E-value
Superfamily FAS1 domain 1.12e-20
Family FAS1 domain 0.0089
Further Details:      
 
Domain Number 8 Region: 381-504
Classification Level Classification E-value
Superfamily FAS1 domain 7.98e-19
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 9 Region: 1474-1513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000942
Family EGF-type module 0.072
Further Details:      
 
Domain Number 10 Region: 1516-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000903
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049946
Domain Number - Region: 2086-2122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000519
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 235-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000572
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 2132-2165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 325-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 1385-1512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00204
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 877-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-like domain of nidogen-1 0.049
Further Details:      
 
Domain Number - Region: 2000-2123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00738
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 921-952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 198-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0121
Family Merozoite surface protein 1 (MSP-1) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049946   Gene: ENSPTRG00000005368   Transcript: ENSPTRT00000050659
Sequence length 2551
Comment pep:known chromosome:CHIMP2.1.4:12:103893736:104079200:1 gene:ENSPTRG00000005368 transcript:ENSPTRT00000050659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLQHLVIFCLGLVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTK
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPRCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT
CECYSAYTGPKCDKPIPECAALLCPENSRCSPSTEDENKLECKCLPNYRGDGKYCDPINP
CLRKICHPHAHCTYLGPNRHSCTCQEGYRGDGQVCLPVDPCQINFGNCPTKSTVCKYDGP
GQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANCTTVAPGRTECICQKGYVGDGLT
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNV
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDTFYTLTGKSGEIFNSDKDNQIKLKLYGG
KKKVKIIQGDIIASNGLLHILDRAMDKLEPTFESNNEQTIMTMLQPRYSKFRSLLEETNL
GHALDEDGVGGPYTIFVPNNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVA
TLISTPHIRSMANQLIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTHRCVYSGRFGSLKSGCARYCN
ATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGFQGSQCQFCSD
PNKYGPRCNKKCLCVHGTCDNRIDSDGACLTGTCRDGSAGRLCDKQTSACGPYVQFCHIH
ATCEYSNGTASCICKAGYEGDGTVCSEMDPCTGLTPGGCSRNAECIKTGTGTHTCVCQQG
WTGNGRDCLEINNCLLPSAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQ
TGKCHPLASCQSTSSGVWSCVCQEGYEGDGFLCYGNAAVELSFLSEAAIFNRWINNASLQ
PTLSATSNLTVLVPSQQATEDMDQDEKSFWLSQSNIPALIKYHMLLGTYRVADLQTLSSS
DMLATSLQGNFLHLAKVDGNITIEGASIVDGDNAATNGVIHIINKVLVPQRRLTGSLPNL
LMRLEQMPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNNAIENYIREKKVLSLEEDVLR
YHVVLEEKLLKNDLHDGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHG
LGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKMRCIYTSYFMGRRTLF
IGCQPKCVRTVITRECCAGFFGPQCQPCPGNAQNVCFGNGICLDGVNGTGVCECGEGFSG
TACETCTEGKYGIHCDQACSCVHGRCNQGPLGDGSCDCDVGWRGVHCDNATTEDNCNGTC
HTSANCLTNSDGTASCKCAAGFQGNGTICTAINACEISNGGCSAKADCKRTTPGRRVCTC
KAGYTGDGIVCLEINPCLENHGGCDKNAECTQTGPNQAACNCLPAYTGDGKVCTLINVCL
TKNGGCSEFAICNHTGQVERTCTCKPNYIGDGFTCRGSIYQELPKNPKTSQYFFQLQEHF
VKDLVGPGPFTVFAPLSAAFDEEARVKDWDKYGLMPQVLRYHVVACHQLLLENLKLISNA
TSLQGEPIVISVSQSTVYINNKAKIISSDIISTNGIVHIIDKLLSPKNLLITPKDTSGRI
LQNLTTLATNNGYIKFSNLIQDSGLLSVITDPIHTPVTLFWPTDQALHALPAEQQDFLFN
QDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAWKTLQGSELSVKCGAGRDIGDLFLNGQTC
RIVQRELLFDLGVAYGIDCLLIDPTLGGRCDTFTTFDASGECGSCVNTPSCPRWSKPKGV
KQKCLYNLPFKRNLEGCRERCSLVIQIPRCCKGYFGRDCQACPGGPDAPCNNRGVCLDQY
SATGECKCNTGFNGTACEMCWPGRFGPDCLPCGCSDHGQCDDGIMGSGQCLCETGWTGPS
CDTQAVLPAVCTPPCSAHATCKENNTCECNLDYEGDGITCTVVDFCKQDNGGCAKVARCS
QKGTKVSCSCQKGYKGDGHSCTEIDPCTDGLNGGCHEHATCKMTGPGKHKCECKSHYVGD
GLNCEPEQLPIDRCLQDNGQCHADAKCVDLHFQDTTVGVFHLRSPLGQYKLTFDKAREAC
ANEAATMATYNQLSYAQKAKYHLCSAGWLETGRVAYPTAFASQNCGSGVVGIVDYGPRPN
KSEMWDVFCYRMKDVNCTCKVGYVGDGFSCSGNLLQVLMSFPSLTNFLTEVLAYSNSSAR
GRAFLEHLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHLANVSMFFYNDLVNGTTLQTR
LGSKLLITASQDPLQPTETRFVDGRAIVQWDIFASNGIIHVISRPLKAPPAPVTLTHTGL
GAGIFFAIILVTGAVALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYE
STTSAPPEPSYDPFTDSEERQLEGNDPLGTL
Download sequence
Identical sequences A0A2J8N000
ENSPTRP00000049946 ENSPTRP00000049946 9598.ENSPTRP00000049946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]