SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pan troglodytes 69_2.1.4 > ENSPTRP00000050000

Domain assignment for ENSPTRP00000050000 from Pan troglodytes 69_2.1.4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPTRP00000050000
Domain Number 1	Region: 107-148
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000000838
Family	EGF-type module	0.016
Further Details:

Domain Number 2	Region: 28-65
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000157
Family	EGF-type module	0.018
Further Details:

Domain Number 3	Region: 142-181
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000000188
Family	EGF-type module	0.0075
Further Details:

Domain Number 4	Region: 69-105
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000141
Family	EGF-type module	0.0095
Further Details:

Domain Number 5	Region: 185-211
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000463
Family	EGF-type module	0.015
Further Details:

Weak hits

Sequence:	ENSPTRP00000050000
Domain Number -	Region: 1-41
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.013
Family	EGF-type module	0.041
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPTRP00000050000 Gene: ENSPTRG00000001194 Transcript: ENSPTRT00000048318
Sequence length	236
Comment	pep:known chromosome:CHIMP2.1.4:1:116598819:116682040:1 gene:ENSPTRG00000001194 transcript:ENSPTRT00000048318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MCVTYHNGTGYCKCPEGLLGEYCQHRDPYEKNRCQNGGTCVAQAMLGKATCRCASGFTGE DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQDGGTCLNLPGSYQCQCPQGFTGQYCD SLYVPCAPSPCVNGGTCRQTGDFTFECSCLPETVRRGTELWERDRQVWNGKEHDEN
Download sequence
Identical sequences	ENSPTRP00000050000 ENSPTRP00000050000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]