SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050069 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPTRP00000050069
Domain Number - Region: 102-214
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.087
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050069   Gene: ENSPTRG00000018207   Transcript: ENSPTRT00000057220
Sequence length 306
Comment pep:known chromosome:CHIMP2.1.4:6:44262581:44273914:1 gene:ENSPTRG00000018207 transcript:ENSPTRT00000057220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVPLGRSLTLSPRLEHNGMTSAHHNFRLPGSRDSPASASQVAEIIDLEWFEKSEETHA
SQIELLETSSMQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLP
LPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVP
RVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPL
MGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVT
LKGFRE
Download sequence
Identical sequences H2R790
ENSPTRP00000050069 ENSPTRP00000050069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]